KEGG   Runella slithyformis: Runsl_1376Help
Entry
Runsl_1376        CDS       T01553                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rsi  Runella slithyformis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Runsl_1376
Enzymes [BR:rsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Runsl_1376
Exosome [BR:rsi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Runsl_1376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1569507..1571321)
Genome map
AA seq 604 aa AA seqDB search
MEIATEARYPKSEMVGMGAIVVEEGVSFRVWAPNAKKVFVMGDFNEWKKNTVPLVREDNG
YWSVEVPEAKAGQQYKYVLKTKAGELIRNDPYARELTNSVGNSIIHDPTFEWGEDHFQCP
HRNEMVIYELHVGTFNVKEEGKPGDFYSVIERLNYFKSLGINAIELMPVAEFPGGYSWGY
NPAHPFAVESEYGGPRGLKELVKAAHAKGIAVILDVVYNHFGPTDMDLWQFDGWQENGLG
GVYFYNDWRAKTPWGDTRPDYGRPEVRQYIRDNALMWLDEYHIDGLRMDMVPYIRNVNAD
GNPANDLKEGYSLIQWINSEIQAHFPGRFTVAEDLHSLDCITAPVEHGGLAYSSQWDGEF
VHPIREAIITAHDEDRDINKVAKSIMHRYNHDAFERVIYTESHDEVANGKARVVQEIAGR
EDVNTWYAKKRSTLGVALMMTSPGIPMLFQGQAILEDKWFEDTDPIDWSRFSEFKGIVKL
YRDLIHLRLNKQGVTRGLTGQHAAMLVIDNDRKLIAFHRWKDGGAGDNTVVVMNFSHQAI
EDYAVPFPEEGLWKIRFNSDWEGYDSDFDNYFSHDTQATGHRENEALIARVAIGPYSTIV
YSKE
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcgccactgaagcaagatatcctaaaagcgaaatggttgggatgggagcgatt
gtggtggaagaaggagtttcgtttagggtttgggctcccaatgcaaaaaaagtttttgtc
atgggggattttaatgaatggaaaaaaaataccgttccgctggtgcgggaagacaatggc
tattggtcggtcgaagtgccggaggctaaagccggacaacaatacaaatacgtattgaaa
accaaggcaggggagttgatacgcaatgatccgtatgcccgtgagttgaccaactcggtc
ggaaacagcatcattcatgatccaacctttgagtggggcgaagaccactttcaatgtccc
caccggaatgaaatggtgatctatgagctccatgtcgggactttcaacgtcaaagaagaa
ggaaagcccggagatttctacagcgtcattgaacgactcaattattttaaatcgctggga
atcaacgccattgagctcatgcccgtcgcggagtttccgggggggtattcgtgggggtac
aatcccgcccatccgtttgccgtagagtcagagtacggcggcccgcgaggcctcaaagag
ttggtgaaggccgcgcacgccaagggaattgcggtcatccttgatgtggtgtataaccac
ttcggacctactgacatggacctgtggcagtttgacggctggcaggaaaatggactcgga
ggggtttatttttacaacgactggcgcgccaaaaccccctggggagacacccgacccgac
tatggacggccggaagtacgccaatatattcgggacaatgccctgatgtggctggacgag
taccatatagatggattacggatggacatggtcccgtacatacgaaatgtcaatgcggat
ggcaatccggccaatgatttgaaagaaggctacagcctgattcagtggatcaattcagag
attcaggctcattttccggggaggtttaccgtagcggaagatttacatagcctggattgc
attacagcccctgtagagcacggaggcttggcgtacagcagtcagtgggatggggaattt
gtgcatccaatccgggaagcgatcattacggcgcacgacgaagaccgcgacataaacaag
gtagcgaaatcgatcatgcatcgttataatcatgacgcatttgagcgggtgatctacacc
gagtcgcacgatgaagtcgccaacggaaaagcccgggtagtgcaggaaattgccggccgg
gaagacgtcaatacgtggtatgccaaaaagcgctctacgctcggggtggcattgatgatg
acttcaccgggtattccgatgctgtttcagggacaggctattttggaagataaatggttt
gaagatacggaccccattgactggagccgtttttcggaattcaagggtattgtaaaatta
taccgcgatttgattcatttacggcttaataaacaaggcgttacgcgtggccttacgggg
cagcatgcagcaatgcttgtgatcgacaatgaccgtaagctgatcgcttttcaccgttgg
aaagacggcggcgcgggagataatacggtggtggtgatgaatttttcccatcaggccatt
gaggattacgcggtaccgtttcccgaagaagggctgtggaagatacgatttaacagtgat
tgggaaggctacgacagtgattttgataattatttcagtcatgatacccaagcaacgggg
caccgggaaaacgaagccttgattgcgcgggtggccatcggtccgtacagcacgattgtt
tactcaaaagaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system