KEGG   Runella slithyformis: Runsl_1501Help
Entry
Runsl_1501        CDS       T01553                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rsi  Runella slithyformis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Runsl_1501
Enzymes [BR:rsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Runsl_1501
Exosome [BR:rsi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Runsl_1501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1712285..1713265
Genome map
AA seq 326 aa AA seqDB search
MNYSIIRRPRRNRQSEAIRALVQETTVSVNDLIYPMFLLDGQGIKSEVKSMPGIYRYSLD
TLLEELKEVTDLGIKCIDLFPNYAEDKKDKYATESYREGTFYLDALKAVKDHFPELALMT
DIAMDPYSSDGHDGLVENGKILNDETLEILGKMAVAQARAGADILGPSDMMDGRVGYIRQ
ALDAEGFTNVSIMSYSVKFASAFYGPFRDALDSAPRFGDKKTYQMNPANVREALIEAALD
YEEGADFLMVKPALAYLDVIKTLDQNFDLPIAAYNVSGEYAMLKAAAQNGWLDGDRAMLE
TLLSIRRAGAKIILTYFAKEFALLQA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaactactccatcattcgccgtccgcgtcgcaatcgacaatcggaggccattcgagct
ttggttcaggaaacgaccgtttccgtcaatgaccttatctatcccatgtttcttctggat
gggcaaggcatcaaaagtgaggtcaaatccatgccgggtatttaccgttattcgctggat
acactgttggaagaactgaaagaagtcacagacttaggcatcaaatgcattgatctgttt
cccaattatgccgaagataagaaagataaatatgccaccgagagctatcgggaaggcaca
ttttatctggacgcgctgaaagcggtaaaagatcactttccggagttggccttgatgacc
gacattgctatggacccgtacagcagcgacggccacgatggattggtggaaaacggtaaa
attctaaacgacgaaacccttgagattctggggaaaatggccgttgcgcaggcacgcgcc
ggcgctgatattctggggccaagcgatatgatggacgggcgcgttggctacatccgccaa
gccttggatgccgaaggctttaccaacgtcagcatcatgtcgtactccgtcaaatttgcc
agcgccttttacggtcctttccgcgatgcgctggattcggctccgcgtttcggcgataaa
aaaacctatcagatgaatcccgccaacgtgcgcgaagccctcatcgaagccgccttggat
tatgaagaaggagctgactttttgatggtcaaacctgcactcgcgtatttggatgtcatt
aagaccttagatcagaattttgacctgccgattgcggcgtataacgtatccggcgaatac
gcaatgctcaaagcagcggcccaaaacgggtggctggacggagaccgcgccatgctcgaa
acactgctttcgattcggagagccggcgccaaaattatcctgacatactttgccaaagaa
tttgcccttctgcaagcgtaa

DBGET integrated database retrieval system