KEGG   Runella slithyformis: Runsl_1763Help
Entry
Runsl_1763        CDS       T01553                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rsi  Runella slithyformis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Runsl_1763
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Runsl_1763
Enzymes [BR:rsi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Runsl_1763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1989259..1990179
Genome map
AA seq 306 aa AA seqDB search
MSQLSVRHLLGIKNLTESDIYSILDTATQFKDVINRPIKKVPSLRDVTIANVFFENSTRT
RLSFELAEKRLSADVVNFSASGSSVKKGETLLDTVNNILAMKVDMIVMRHSSPGAPHYLA
QRISANVVNAGDGTHEHPTQALLDAFSIREKIGDLAGKKIAIIGDILHSRVALSNIFCLI
KLGAEVRVCGPTTLIPKYISSLGVQVSHNVKETLQWCDVANVLRIQLERLQVKYFPSLRE
YSLYFGINKKMLDELDHEILLMHPGPINRGVELTSDAADSRQSIILNQVENGVAVRMAVL
YLLAQQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaactttctgtacggcaccttttgggcatcaaaaacctcaccgaatcagacatt
tacagtattttagataccgctacccagtttaaagacgtcatcaatcgccccatcaaaaaa
gtgccttcactgcgggatgtcactattgccaacgttttttttgaaaattctacccggacc
cgtctgtcatttgaattagccgaaaaaagactttccgccgacgttgtcaatttttccgct
tcgggcagttccgtcaagaaaggggagacgcttttagatactgtcaataacattttggcg
atgaaagtcgacatgatcgtcatgcgacacagcagcccgggagcacctcattatttagcc
caacgaatttccgccaatgtggtcaatgccggcgacggcacccacgagcaccctacgcag
gcgctgttggatgccttttccatccgggaaaaaataggtgatctcgccggcaagaaaatt
gccatcatcggtgatattctgcactcacgtgtggcactgtccaatattttctgtctgata
aaattaggggcggaggttcgggtttgcggacctactacgctcattcccaaatatatttcc
tctttaggcgtacaggtcagtcataacgtcaaagaaacccttcaatggtgcgatgtggcc
aacgtactgcgtattcagctggagcgcttacaggtaaaatactttccgagtctgcgggag
tattcgctgtatttcggcatcaataaaaagatgttggatgaactcgaccatgaaatcctg
ctgatgcaccccgggcccatcaatcggggcgtggagctcacctccgatgccgccgattca
cgccaaagcattatcttgaatcaagtcgaaaacggagtagctgtacgaatggcggtgctt
tatctgttggcacaacagtag

DBGET integrated database retrieval system