KEGG   Runella slithyformis: Runsl_1763Help
Entry
Runsl_1763        CDS       T01553                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rsi  Runella slithyformis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rsi00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rsi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1989259..1990179
Genome map
AA seq 306 aa AA seqDB search
MSQLSVRHLLGIKNLTESDIYSILDTATQFKDVINRPIKKVPSLRDVTIANVFFENSTRT
RLSFELAEKRLSADVVNFSASGSSVKKGETLLDTVNNILAMKVDMIVMRHSSPGAPHYLA
QRISANVVNAGDGTHEHPTQALLDAFSIREKIGDLAGKKIAIIGDILHSRVALSNIFCLI
KLGAEVRVCGPTTLIPKYISSLGVQVSHNVKETLQWCDVANVLRIQLERLQVKYFPSLRE
YSLYFGINKKMLDELDHEILLMHPGPINRGVELTSDAADSRQSIILNQVENGVAVRMAVL
YLLAQQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaactttctgtacggcaccttttgggcatcaaaaacctcaccgaatcagacatt
tacagtattttagataccgctacccagtttaaagacgtcatcaatcgccccatcaaaaaa
gtgccttcactgcgggatgtcactattgccaacgttttttttgaaaattctacccggacc
cgtctgtcatttgaattagccgaaaaaagactttccgccgacgttgtcaatttttccgct
tcgggcagttccgtcaagaaaggggagacgcttttagatactgtcaataacattttggcg
atgaaagtcgacatgatcgtcatgcgacacagcagcccgggagcacctcattatttagcc
caacgaatttccgccaatgtggtcaatgccggcgacggcacccacgagcaccctacgcag
gcgctgttggatgccttttccatccgggaaaaaataggtgatctcgccggcaagaaaatt
gccatcatcggtgatattctgcactcacgtgtggcactgtccaatattttctgtctgata
aaattaggggcggaggttcgggtttgcggacctactacgctcattcccaaatatatttcc
tctttaggcgtacaggtcagtcataacgtcaaagaaacccttcaatggtgcgatgtggcc
aacgtactgcgtattcagctggagcgcttacaggtaaaatactttccgagtctgcgggag
tattcgctgtatttcggcatcaataaaaagatgttggatgaactcgaccatgaaatcctg
ctgatgcaccccgggcccatcaatcggggcgtggagctcacctccgatgccgccgattca
cgccaaagcattatcttgaatcaagtcgaaaacggagtagctgtacgaatggcggtgctt
tatctgttggcacaacagtag

DBGET integrated database retrieval system