KEGG   Runella slithyformis: Runsl_2231Help
Entry
Runsl_2231        CDS       T01553                                 

Definition
glycerol-3-phosphate acyltransferase
Orthology
K08591  
glycerol-3-phosphate acyltransferase PlsY [EC:2.3.1.15]
Organism
rsi  Runella slithyformis
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rsi00561]
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:rsi00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2571157..2571798
Genome map
AA seq 213 aa AA seqDB search
MNSWHIWSAIITAYLLGSIPSAIWYGEAYFGIDVRKFGSGNAGATNTFRVLGKRAGTIVL
LIDVLKGWTATKLASILFFLEVIEPAQVPTAKLILGFSAVLGHLYPIFVRFKGGKGVATS
LGMILAIDPLVASVCIVIFVLVLLVSHYVSLSSIIAAFAFPMILVLGVFGKSSTLLIVFG
FLLFAVVVITHQKNIVRLLNGSESRVNLWRRRK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaatagttggcacatttggtctgccattatcactgcttacctgttgggatccatcccc
tcggccatttggtacggggaagcgtattttggaattgatgttcggaaatttgggagtgga
aatgcgggggcgacgaatacattcagggtattgggcaagcgtgcaggaaccatcgtatta
ctgatcgatgtcctcaaagggtggacggccaccaagttggcaagtattctgttctttctg
gaggtcattgagccggctcaggttcctacggccaagttgatcttaggtttttcggccgtt
ttgggtcatttatatcccatttttgttcgttttaagggagggaaaggtgtagccacttct
ttgggtatgatcctggccattgatcccttggtcgcgtcggtctgtattgtcatatttgtg
cttgtattgttggtatctcactatgtatcattgagttcgatcattgccgcttttgctttt
ccgatgatattggtcttgggggttttcggcaagtccagcaccttattgatcgtttttgga
tttctgctgtttgcggtagtggtgatcacgcatcaaaagaacatcgttcgtctgctcaac
ggcagcgaaagcagagtgaatctctggcggcgtcgcaaataa

DBGET integrated database retrieval system