KEGG   Runella slithyformis: Runsl_2268Help
Entry
Runsl_2268        CDS       T01553                                 

Definition
glucan endo-1,6-beta-glucosidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
rsi  Runella slithyformis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Runsl_2268
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Runsl_2268
Enzymes [BR:rsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Runsl_2268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2614290..2615669
Genome map
AA seq 459 aa AA seqDB search
MMKRLIAACIALLPVISHAQRATLWLTKANQSVLFQKQTESLAFGPISGTASSIYVDETK
RFQSMDGFGYTLTGGSATLINGLKPAEKAALLRELFAIDADNIGVSYLRISVGASDLSDH
VFTYNDLPAGQTDPTLNRFSLVEEQKDLIPVLKQVLAINPQLKILASPWTPPSWMKTNHD
SKGGNLKPEFYDAYARYLVKYIQEMKKQGIRIEALTVQNEPLHPGNNPSLFMPQDEQANF
IKKSLGPAFKAAKLNTKIIIYDHNADRPDYPISILNDPEARKYIDGSAFHLYGGGIDALR
DVHEAHPDKNLYFTEQWIGAPANFGGDLLWHVKNLVIGAPRNWSKTVLEWNLAADPKQNP
HTDGGCTACLGALTIGESIIRNPAYYIIAHASKFVRPGSVRIVSNVTLSLPNVAFKTPDG
KTVLIVLNESDKPTTFNIRTKSKQLTPTLSGKTVATFVW
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaagactgattgctgcctgtattgccctccttcccgtcatttcccacgcccaa
cgggccaccctgtggctgaccaaagccaaccaatcggtgttgttccaaaaacaaacggag
tcgttggcctttgggccgatctccggcacggcatcgagtatctatgtggatgagaccaag
cggtttcaatccatggacgggttcggctatacgctcacgggcgggagtgccacgttgatc
aatggcctcaaaccggcagaaaaagcggcgttgctgagggaattgtttgccatcgatgcc
gataacatcggcgtcagttacctgcgtatcagcgtcggagcgtcggatttgagcgatcat
gtctttacgtacaacgacctgcctgcgggccaaaccgacccgacactcaaccgattttcg
ttggttgaagaacaaaaagacctgattccggtcctgaagcaggtcttggcgatcaatcct
caactcaaaattctggcctcgccctggacgccgccttcgtggatgaaaaccaaccatgat
tcaaaaggcggtaacctcaaacccgagttttatgacgcgtatgcccggtatttggtgaaa
tacattcaggaaatgaaaaagcaggggattcggatagaggcgctgacggtgcagaacgag
ccgctgcaccccggcaacaatcccagcctgttcatgccgcaggacgagcaggccaacttc
atcaaaaagagccttgggcccgctttcaaagcggccaaactcaataccaagatcatcatc
tacgaccacaacgccgaccgtcccgattaccccatcagtatcctcaacgaccccgaagcg
cggaaatacattgacggctcggcgtttcacctgtacggcggcggcatcgacgccctgcgc
gatgtacacgaggcacatcccgacaaaaacctgtattttacggaacaatggatcggtgca
ccggccaattttggcggtgatttgctgtggcacgtcaaaaatctggtgatcggtgccccg
cgaaattggagcaaaacggtgctggaatggaacctcgccgccgacccgaagcaaaatccg
cataccgacggcggctgcacggcctgcctgggggcccttacgatcggagaaagtatcatc
cgaaatccggcgtattacatcatcgcccacgcgtcaaagttcgtgcggcccggttcggta
cgcatcgtttctaacgtgaccctaagcctgcccaacgtagcattcaaaacccccgatggc
aaaacggtactgatcgtgctgaacgaaagtgataaacccacgacgttcaatatccgcacc
aagagcaaacaactcacgcccacgctcagtggcaaaacggtcgccacgtttgtgtggtaa

DBGET integrated database retrieval system