KEGG   Runella slithyformis: Runsl_2404Help
Entry
Runsl_2404        CDS       T01553                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rsi  Runella slithyformis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Runsl_2404
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Runsl_2404
Enzymes [BR:rsi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Runsl_2404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2767818..2768399)
Genome map
AA seq 193 aa AA seqDB search
MATIKLLSVMLLSLISGLFADKKEIKTNTANAKPTASVYDYKMKALMGNEEISLSKYKGK
KIVLLNVASACGYTPQYADWQKFHEQYGDKIVVLGFPANNFGAQESGSNSEIAAFCQKNY
GVTFQMFSKIDVTGDNQHPLYRWLSTKSLNGWNDKAPSWNFCKYVVDENGKLTHFFASKI
KPTDDEFKKAVGI
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaatcaaattactttctgttatgcttttatccctcatttcaggcctttttgcc
gataaaaaagaaatcaaaaccaataccgcaaacgccaaaccgaccgcttctgtgtacgat
tataagatgaaagccctgatgggtaacgaagagatttcactgagcaaatacaaaggcaaa
aaaattgtgctcctcaacgtagcctctgcctgcggttatactccacagtatgcagattgg
caaaaatttcatgagcaatacggcgacaagatcgtggtactgggctttcccgccaacaac
ttcggtgcgcaggaatccggctccaattcagaaattgcggctttttgccaaaaaaattac
ggcgttacgttccaaatgttctccaaaatcgacgtaaccggcgacaatcaacacccactg
taccgctggctgtcgaccaaatcgctcaacggatggaacgacaaagccccttcctggaat
ttctgcaaatacgtggtagatgaaaacggtaaattgacgcatttctttgcctccaaaatc
aaacctaccgacgatgaattcaaaaaagccgtaggcatttaa

DBGET integrated database retrieval system