KEGG   Runella slithyformis: Runsl_2404Help
Entry
Runsl_2404        CDS       T01553                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rsi  Runella slithyformis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:rsi00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:rsi00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2767818..2768399)
Genome map
AA seq 193 aa AA seqDB search
MATIKLLSVMLLSLISGLFADKKEIKTNTANAKPTASVYDYKMKALMGNEEISLSKYKGK
KIVLLNVASACGYTPQYADWQKFHEQYGDKIVVLGFPANNFGAQESGSNSEIAAFCQKNY
GVTFQMFSKIDVTGDNQHPLYRWLSTKSLNGWNDKAPSWNFCKYVVDENGKLTHFFASKI
KPTDDEFKKAVGI
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaatcaaattactttctgttatgcttttatccctcatttcaggcctttttgcc
gataaaaaagaaatcaaaaccaataccgcaaacgccaaaccgaccgcttctgtgtacgat
tataagatgaaagccctgatgggtaacgaagagatttcactgagcaaatacaaaggcaaa
aaaattgtgctcctcaacgtagcctctgcctgcggttatactccacagtatgcagattgg
caaaaatttcatgagcaatacggcgacaagatcgtggtactgggctttcccgccaacaac
ttcggtgcgcaggaatccggctccaattcagaaattgcggctttttgccaaaaaaattac
ggcgttacgttccaaatgttctccaaaatcgacgtaaccggcgacaatcaacacccactg
taccgctggctgtcgaccaaatcgctcaacggatggaacgacaaagccccttcctggaat
ttctgcaaatacgtggtagatgaaaacggtaaattgacgcatttctttgcctccaaaatc
aaacctaccgacgatgaattcaaaaaagccgtaggcatttaa

DBGET integrated database retrieval system