KEGG   Runella slithyformis: Runsl_2599Help
Entry
Runsl_2599        CDS       T01553                                 

Definition
signal transduction histidine kinase with CheB and CheR activity
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
rsi  Runella slithyformis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rsi02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rsi02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3002885..3006640
Genome map
AA seq 1251 aa AA seqDB search
MANKTASPSEGEKENVPIVAIGASAGGLDAVSELLRHLSPTTNMCYVYVQHPDPSQDNRL
SAVLSKVTQMTVRDAEYEMPLRPNEVYVIPPDKDMEIIDGLLVHRPRNEETFMHMPIDRF
FVSLSERQREGAIALLLSGMGTDGTLGLKAVKMSGGITFAQDETARFRSMPMAAIGEGVV
DMVMSPEDMAREIGRLSQKATVFLRVKEDGSGNEEDADTDLRIILQLLLKATGVDFSHYK
INTIQRRINRRIVLYRLESLRDYAKYLREHPLEVGILYNDLLINVTQFFRDQETVSYLQK
VILPQIIHIKPAQEPIRIWVPACATGEEAYSLAMLLMEVFEELSISRPIQIFATDLSEIA
IAKARLGTYTQSELLGVSPKRLQRFFTKADDQYRIIRHIRDVCVFAPHNLFKDPPFSRLD
LISCCNLFIYLDTTLQKQAISIFHYALNAAGFLQLGKSETIGGAGAIFAQVEKSVKIYVR
KNDTAVLPSLQINSRSRESDRTGSSSRRGFTLKETVFNSNELDKEVDALLLAQYVPASVV
VNQDLDILQFRGSTGLFLEPSPGKASLNLLKMARPDLVFELRSLVHKVKKTGKTAHKTGL
ELNVKGNVHQVEVEALPLRNEAAERLILIVFREIPLTDVSLRPSVARDRRIRQLEEELAL
AREDMRSIIEDQEANNEELQSANEEIVSSNEELQSINEELETSKEEIESTNEELITINQE
LQLRNDQLSEAQEYANVIFGTIREATLMLDRSLRVRSANVAFYKTFHARAEETEGRLIYE
LDERQWDIPELRHLLENIIPYKGHFQGFEVRHTFPGVGEKIMMLNAKMVMQQPNRQEMIL
LVIEDITEHRQVQRLLEEREAWFHGMADNAPVLIRVAGTDGLYNFFNKTWLEFTGRTMEE
ETGHGWTQRIQPDDRECYQQLYDEHFHSRQPYRTEYRLMRHDGAYRWMLENGKPLFSIDG
EFIGYMGTCAEVHDQKMENEVLEAKVKQRTQDLYEANANLKRSNEELRQYAYIASHDLQE
PLRKIVTFSGRIQKKFAESLPEQGHEYLAKIVTSAQRMTRLIDDLLTFSRTIHQNKNFVT
VDLNEVLRGVLQDFDLTISEKNAAVRAAHLPTIEAVPLQMAQLFYNLVGNALKFTSGSKP
PLISIEAKEATVEEVHHHISQAAPGVYWKISVRDNGIGFDPAYSEQIFSIFQRLHDRDTY
MGTGIGLALCRRIINNHDGDLYAEGKEGEGAIFHLLLPAKQSQTERKFSES
NT seq 3756 nt NT seq  +upstreamnt  +downstreamnt
atggccaacaaaacagcttcaccatcggaaggagagaaagaaaatgtgccgattgtggct
attggagcctctgccggcggcttggatgccgtttcggagttgttgcggcatctatcgccg
actacgaacatgtgctatgtgtatgtgcagcatccggacccctcccaagataacaggcta
tcggctgtattgagcaaagttacgcagatgaccgtgcgggatgccgagtacgaaatgccg
ctccgtcccaatgaagtgtacgttattccgcccgataaagacatggaaatcatcgatgga
ttactggtacaccgtccgcgcaatgaggagacttttatgcacatgcccattgatcgtttc
tttgtctctctttccgaacgccaaagagaaggtgccattgcattgcttttgtccggaatg
ggcactgacggcactctgggcctgaaagccgtcaaaatgtcgggagggatcacttttgcc
caagatgaaacggcgcgatttcgcagtatgccgatggccgcgattggggaaggagtggta
gatatggtgatgtcgccggaggatatggcccgggaaatagggcgattaagccaaaaagcc
actgtttttttgcgggtcaaagaggatggatccggcaatgaagaagatgccgataccgac
ctgcgcatcattcttcaactcctgctgaaagcaacgggggtggatttcagccattataaa
ataaataccattcagcgccggatcaaccggcgaatcgtactttaccggttagaatcactg
cgcgattatgcaaagtacctgcgcgagcatccgctcgaagtgggcatcctgtacaatgat
ctgttgatcaatgtgacccagtttttccgtgaccaagagactgtctcttaccttcaaaag
gtcatattaccccagatcatccacatcaagcctgctcaggaaccgatacggatttgggtg
cccgcctgcgctacgggtgaagaggcctactccctggccatgcttctgatggaagtgttt
gaggaattgtcgatcagcagaccgattcagatctttgccaccgacctgagtgaaatcgcc
atcgcgaaggcacgcctcggaacctacacccaatcggaactgctcggggtatccccaaaa
cgattgcagcgtttttttacgaaagcagatgatcagtaccgcatcatcaggcacattcgg
gatgtgtgcgtttttgctcctcataatctttttaaagatccgcctttttcccgtcttgat
ctcatcagttgttgcaatctgtttatttacctggacactacgctgcaaaaacaggcgatt
tccatttttcattatgccctcaatgctgccggctttctgcaattgggcaagtctgaaacc
atcggcggggcgggggctatttttgcgcaggtggaaaagtcagtcaaaatctatgtccga
aaaaacgatacggcggtgctgccctccctgcaaataaactcccgaagcagagagtcagat
cggacaggaagcagcagccggcggggatttacgctgaaagaaacggtcttcaacagcaat
gagttggataaggaagtggatgcccttttactggctcagtatgtgccggcgagtgtagtg
gtcaatcaggatttggatattttgcagtttaggggttctacaggattgtttctcgaaccc
tctccgggcaaggccagtctcaacttgctcaaaatggcccgccctgatctggtctttgaa
ttgcgcagtttggtacataaagtcaaaaaaacgggcaaaacggcacacaagacgggtttg
gaactcaacgtcaaaggaaacgttcatcaggtagaagtggaagccttgccgctgagaaac
gaggccgcggagcggctgatattaattgtttttcgggaaattcccctcaccgacgtttcg
ctacgcccttcggtggcccgtgaccggcgcatccggcaattggaagaagagctggcgctg
gcgcgggaagatatgcgttccatcattgaagaccaggaggccaataatgaggagttgcaa
tcggccaatgaggagatcgtgagcagcaatgaagagttgcagagcatcaacgaagagctg
gaaacgagcaaagaagaaatagaatcgaccaatgaagaactcattacgatcaatcaggag
ttgcagctgcgcaatgaccaattgagcgaagcacaggaatatgctaatgtcatctttggc
acaatacgggaggccacgctcatgctggatcgcagtttacgggttcgcagtgccaacgtg
gccttctataagaccttccatgcccgggccgaagagacagaaggccgcctgatctatgaa
ctggacgaacgccagtgggatattcccgaactgcgccatcttttggaaaacattattccg
tacaaagggcattttcaggggtttgaagtacgacatacgtttcccggcgtgggcgaaaaa
ataatgatgctcaacgccaagatggttatgcagcagccgaatcgccaggaaatgatcctg
ctggtgatcgaggatattaccgagcacagacaggtgcagcgcctgttggaagagcgtgag
gcgtggtttcacgggatggccgacaacgcccccgtgctcatccgggtggccggtaccgat
gggttgtataactttttcaataagacctggctggaatttacggggcgtaccatggaagaa
gaaacgggccacggttggacgcagcgcattcagcccgatgatcgggaatgctatcagcaa
ctttacgatgagcattttcacagccggcagccgtaccgtaccgaataccgcctgatgcgg
catgacggagcataccgctggatgctcgaaaacgggaaaccgctcttttcgatagacggg
gaatttatcggttatatgggtacctgtgccgaagttcacgatcaaaaaatggaaaatgaa
gtactggaagccaaagtaaaacaacgaacgcaggatttatacgaagccaatgccaacctg
aagcggtctaacgaagagctccgccaatatgcctatatcgccagccatgatctgcaggaa
cccctacgtaagatcgtgactttttcgggacgtattcagaaaaaatttgccgaatcactg
cctgagcaggggcatgaatacctggccaagatcgtgacctcggcgcagcgcatgacccgc
ctgatcgatgatctgctcactttttcgcgtacgatccatcaaaacaaaaactttgttacg
gtcgacctcaatgaggttcttcggggggtgcttcaggattttgatctcaccatttccgaa
aaaaatgcagccgtccgggcggcccacttgcctacaatagaggctgtaccgctccaaatg
gcacaacttttttataatcttgtaggcaatgcattaaaatttacatccggctccaaaccg
ccgctgatcagcattgaggcaaaagaggccactgtagaagaagtacaccatcatatttcg
caggcagcgcccggtgtgtactggaaaatcagcgttcgagacaatggcatcggttttgat
ccggcgtattcggagcagatcttttcgatttttcagcgcctgcacgaccgcgacacttac
atgggcaccggtatcggtctggcactttgccggcgtatcattaataaccacgacggagat
ctatatgccgaagggaaagaaggagagggggcgatatttcatttattacttcctgccaaa
cagagtcagacggaacggaagttttctgaatcataa

DBGET integrated database retrieval system