KEGG   Runella slithyformis: Runsl_2600Help
Entry
Runsl_2600        CDS       T01553                                 

Definition
chemotaxis protein CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rsi  Runella slithyformis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Runsl_2600
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Runsl_2600
Enzymes [BR:rsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Runsl_2600
Two-component system [BR:rsi02022]
 CheA family
  CheA-CheYBV
   Runsl_2600
Bacterial motility proteins [BR:rsi02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Runsl_2600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3006747..3007781
Genome map
AA seq 344 aa AA seqDB search
MTKYDIVVIGSSAGGVYALRELAAALPKDFKASIFVVQHLSSTSPSYLPQILSAAGPLKA
VHPIDGTPIQPGVIYLAPPDHHLLLEPHRVLVKKGPKENRFRPSIDALFRSAAYAYGTRV
IGIILTGLMNDGTSGMWSVKRLGGVGIIQDPEEAMYPSMPESVLEYVEVDYRVAIAELAP
LLVKLTQEEALDSCLLPAEEVKRMRTEIDIAGQKSAFDMGILSIGEPTALTCPECHGALV
QLREGRLIRYRCHTGHAFTANSLLAEVSKAVEDSLWSAIRGLEETVLLLEQTANGLVESG
RTAEAKNFFAESSRTKQQARRLHEFVVRHKQVSEDGPLSTDVER
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatacgatattgtagtgattggatcctcggcgggcggggtatatgctttgcgg
gaattggccgccgctctgccgaaggattttaaagcctctatttttgtggttcagcacctg
tcctcaacatccccaagttatttgccccagattttaagtgctgccggcccgctcaaagcg
gtacatccgatcgacggtaccccaattcagccgggggtcatttatttggccccaccggat
catcacctgcttttggagccccatcgggtcttggtaaaaaaaggtcccaaagaaaaccga
tttcgaccttccattgatgctctttttcggtcggcagcgtatgcttacggcacgcgcgtc
attgggataattctcaccggactcatgaacgacggaacctcgggcatgtggtcggtcaag
cggcttggcggagtgggtatcatccaagatccggaagaggccatgtacccgagtatgcct
gaaagtgtgctcgaatacgtagaggtcgattatcgggttgctattgcggagctcgcaccc
ttactggttaaactgacacaggaagaagcgcttgactcctgcctgttgccggccgaagaa
gtaaaacgaatgcgtactgaaatagatattgccggtcaaaaaagtgcatttgatatgggt
attctttctataggtgagccaacggcgcttacctgccctgaatgtcacggtgccctcgtt
cagttgagggaaggcagactgattcggtatcggtgtcataccggacatgcgtttacggcc
aactctctgttggcagaagtatcaaaagcggtggaagattccctctggagtgctattcgg
gggttggaagaaaccgtactccttctggaacaaacggccaatggcctcgttgaatccgga
cggacggcggaggctaaaaatttctttgcagaatccagccgtaccaagcagcaggcgcgc
aggctgcatgagtttgtggtcaggcacaagcaggtaagtgaagacggtcccctgagcact
gatgttgaacgctaa

DBGET integrated database retrieval system