KEGG   Runella slithyformis: Runsl_2647Help
Entry
Runsl_2647        CDS       T01553                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
rsi  Runella slithyformis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Runsl_2647
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Runsl_2647
Enzymes [BR:rsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Runsl_2647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3078708..3079739
Genome map
AA seq 343 aa AA seqDB search
MSKPILVLKFGSAAITKGNGELNQLVMVEIARQVAQLYAEYHLVIVSSGAVAAGRQYIRH
YAGEIAQRKAAAAIGNLLLLNKYAQFFAPYEIPVAQSLCERGHFANRDQFLQMKETFQEL
WDNGIIPIVNENDVVSSRELKFSDNDELATLIAVGFGADTLMLCTSVGGLLDDRGTIIRK
VAQVNDVFKYVRTDKSSVGLGGMTSKLTFAKLAMRMGIRTIIFGMAEPDSILRALREETG
TVFAPQESALSARNRWLGSGSLVAGRIRIDSGAAQALQNRKSLLAVGIKEVEGDFEAGEA
VEIVDEEGASVAVAKAKEASGIITKNLRTQNFEVANANDIVLL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacccatcttagtactgaaattcgggagcgcagccattacaaaaggcaatggc
gagctgaatcaattggtcatggttgagattgcgcgacaggtcgcgcagttgtacgcagaa
tatcatttggtgattgtgtcgtcgggagcggtagcggccggccggcaatatatccgtcat
tatgccggcgagatcgcccagcggaaagccgccgctgcgatcggaaacctgctgttgttg
aataaatacgcgcagttttttgccccttacgagattcccgtggcccaaagcctttgcgag
cgggggcattttgccaaccgggatcagtttttgcagatgaaagaaacctttcaggaactg
tgggacaacggcatcattccgatcgtaaacgaaaatgacgtggtcagcagccgggagtta
aaattttcggacaacgacgaattggccaccctcatcgccgttggtttcggggccgatacg
ctgatgctctgtacgtcggtcggcggtttgcttgatgaccggggaacgatcattcgcaaa
gtagcacaggtcaatgatgtgtttaaatatgtacggaccgataaatccagcgtaggtttg
ggcggaatgacctctaagctgaccttcgccaaactggccatgcgcatgggtattcggacc
attatctttggcatggccgaacccgacagtattttaagagcgctgcgcgaagaaacggga
acggtgtttgcgccgcaggaaagtgccctttcggcccgcaatcgctggctcgggagcggt
agcctggtggcaggtcgtatccgtatcgacagcggagccgctcaggcgctgcaaaatcga
aaaagcctgttagcagtaggtatcaaagaagtggaaggagattttgaagcaggggaagcc
gtcgaaattgtggatgaagaaggtgcgtcggtggcggtggcaaaggccaaagaggcgtcc
ggtataattacgaaaaaccttcggacccaaaattttgaagtggccaatgccaatgatata
gtgttgctttaa

DBGET integrated database retrieval system