KEGG   Runella slithyformis: Runsl_2666Help
Entry
Runsl_2666        CDS       T01553                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rsi  Runella slithyformis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Runsl_2666
   00670 One carbon pool by folate
    Runsl_2666
Enzymes [BR:rsi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Runsl_2666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3102311..3102805)
Genome map
AA seq 164 aa AA seqDB search
MLLSLIVAAAQNGVIGRDNQLIWHLPDDLKQFKRLTTGHPILMGRKTFESIGKPLPNRTS
IVITRNQHWQFEGVMVVNSVEEAIEAARQTGTDEAFVIGGAEIYRMMLPAVDKIYLTEVK
AIFEGDAFFRIPDQNKWREVQRVPHAADEKHAVAFDFVEWVRRD
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcttctttccctcatcgtggcagcggcccaaaatggcgtcatcgggcgcgacaatcaa
ctgatttggcacttgcccgacgacctgaaacagttcaaacgactcactaccggccatccg
atcctcatggggcgtaagacatttgagtccattggcaagcctctgcccaaccgtacgtct
atcgtcattacacgaaatcagcattggcagtttgagggcgttatggtcgtcaactccgta
gaagaagccattgaagccgctcgccaaaccggaacagacgaagcctttgtgatcggcgga
gcggaaatctaccgaatgatgttgccggcagttgataagatctacctcaccgaagtaaaa
gcaattttcgaaggggatgcctttttccgcattcccgaccaaaacaaatggcgggaggta
cagcgggtgcctcatgccgccgatgaaaaacacgccgtagctttcgactttgtggagtgg
gtacgccgagattaa

DBGET integrated database retrieval system