KEGG   Runella slithyformis: Runsl_2676Help
Entry
Runsl_2676        CDS       T01553                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rsi  Runella slithyformis
Pathway
rsi00010  Glycolysis / Gluconeogenesis
rsi00620  Pyruvate metabolism
rsi00640  Propanoate metabolism
rsi00680  Methane metabolism
rsi01100  Metabolic pathways
rsi01110  Biosynthesis of secondary metabolites
rsi01120  Microbial metabolism in diverse environments
rsi01130  Biosynthesis of antibiotics
rsi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Runsl_2676
   00620 Pyruvate metabolism
    Runsl_2676
   00640 Propanoate metabolism
    Runsl_2676
  Energy metabolism
   00680 Methane metabolism
    Runsl_2676
Enzymes [BR:rsi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Runsl_2676
Lipid biosynthesis proteins [BR:rsi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Runsl_2676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEI49076
UniProt: F8EGH3
Position
complement(3112907..3114796)
Genome map
AA seq 629 aa AA seqDB search
MRIRTFEEYQTAYRHSVEDPEGFWAEVAQEFKWHKPWKKVLDWNFSTPDIKWFVGGKTNI
TENALDRHLRELGNHPAIIWEPNDPSEPSVTLTYKMLHDQVCRFANVLKRNGVVKGDRVC
IYLPMVPEAAIAILACARIGAVHSVVFGGFSAQSLTDRIIDSNCKVIVTSDGAARGNKNI
PMKDTVDDALIACPSVKKVIVLTHTRTAISMIKGRDVWWESEMKQVTSDCPPEVMDSEDP
LFILYTSGSTGKPKGVVHSTGGYMVYSAYTFQNVFQYEQDQVFFCTADVGWITGHSYIVY
GPLLSGATSLMFEGIPTYPDAGRFWDIVDRHKVDILYTAPTAIRSLMGFGLKYVEGKDLS
SLKVLGSVGEPINEEAWNWYNEHIGKGKCPIVDTWWQTETGGILISPIAGVTKTKPTYAT
LPLPGVQPILVDESGKEIEGNGVSGNLCIKYPWPSIIRTTWGDHERCRQTYFSTYPNLYF
TGDGCLRDEDGYYRITGRVDDVLNVSGHRIGTAEVENAINMHSDVIESAVVGYPHDIKGQ
GIYAFVICENTLDDEDLSRRDILATVTRIIGPIAKPDKIQFVRGLPKTRSGKIMRRILRK
IAEGDTSNLGDTTTLLDPSVVDDIKDGAL
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatccgtacatttgaagagtatcaaactgcctaccggcacagtgtagaagacccc
gaaggattctgggccgaagtggctcaggaatttaaatggcacaagccctggaaaaaagta
cttgactggaacttttccacccccgatataaaatggtttgtaggcggcaaaacaaacatc
accgaaaatgccctcgaccgccatttgcgcgagctgggtaatcatcctgccatcatttgg
gagcccaacgacccttccgagcccagcgtgacgctcacctacaaaatgcttcacgaccaa
gtgtgccgttttgccaacgtgctcaaacgcaacggcgtagtgaaaggcgaccgcgtgtgt
atttatctgccgatggttccggaagcggccattgccatcctggcctgtgcccgcatcggc
gcggtacactcggtggtcttcggcggattctcggcccaatccctgaccgaccgtatcatt
gactccaactgtaaagtcattgtgacatccgacggtgcagcgcgcggcaacaaaaacatt
ccgatgaaagataccgtagacgatgcgctcatcgcgtgtccttcggtaaaaaaagtgatc
gttctgacccatacccgtacggccatctccatgatcaaaggccgtgatgtgtggtgggaa
agcgaaatgaagcaggtcacatctgactgtccgccggaagtgatggactccgaagacccg
ctgtttattctttacacctccggctccacgggcaagcccaaaggcgtggttcacagcacg
ggcggttatatggtttactccgcgtatacgttccaaaatgtatttcaatacgaacaggac
caagtcttcttctgtaccgccgatgtgggctggatcacgggccacagctatatcgtgtac
gggccgctgttgagcggggctacttccctgatgtttgaaggcatcccgacctatcccgat
gccggacgtttttgggacattgtagaccgtcataaagtagatattctatacaccgctcct
accgccatccgttcattgatgggttttggcctgaaatacgtggaaggcaaagacctcagc
tcactcaaagtgctgggctcggtaggtgaaccgatcaacgaagaagcctggaactggtac
aacgagcacatcggcaaaggcaaatgtccgatcgtagatacgtggtggcaaaccgaaacc
ggcggtatcctgatttcaccgattgccggtgtgaccaaaaccaagccgacctatgctacc
cttccgctgccgggcgtacagccgatactggtggacgaaagcggtaaagagatcgaaggc
aacggcgtgagcggtaacctttgcattaaatacccctggccgtccatcatccgaacgaca
tggggcgaccacgaacgctgccggcagacgtatttctcgacataccctaatttatacttt
accggcgacggttgccttcgcgacgaagacggttactaccgcatcacaggccgtgtggat
gatgtcctcaacgtatcgggtcaccgtatcgggaccgccgaagtggaaaacgccatcaac
atgcactccgacgtcatcgaaagtgccgtggtaggctatccgcacgacatcaaagggcag
ggtatttatgcgtttgtgatttgtgaaaataccctcgacgacgaagacctttcgcgtcgg
gatattttggccaccgtgacccgcatcatcgggccgatcgccaaacccgataagattcag
tttgtcagaggcttacctaaaacccgttcgggcaagatcatgcgtcggatcctgcgcaaa
attgccgaaggcgacacctccaatctcggcgataccactacacttttagacccatcggtg
gtagatgatatcaaggacggagctttgtaa

DBGET integrated database retrieval system