KEGG   Runella slithyformis: Runsl_2796Help
Entry
Runsl_2796        CDS       T01553                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rsi  Runella slithyformis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Runsl_2796
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Runsl_2796
   00052 Galactose metabolism
    Runsl_2796
   00500 Starch and sucrose metabolism
    Runsl_2796
   00520 Amino sugar and nucleotide sugar metabolism
    Runsl_2796
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Runsl_2796
   00524 Butirosin and neomycin biosynthesis
    Runsl_2796
Enzymes [BR:rsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Runsl_2796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3246912..3247760)
Genome map
AA seq 282 aa AA seqDB search
MTIGVDLGGTKIKAGIEKNGSIIHQNTIFLRQKESLSATLSQLIDLIKPLTHYPATGIGI
GVPSVVDTERGIVYNVANIPSWEKVALRDILEEEFNLPVFVNNDVNCFTLGEHRFGVAKD
FDSVVGMTIGTGLGSGIIIDNQLYTGHNCGAGEIGMLPYRDHNFEYYACSNFFDGIHGTS
ALEASHAAVAGDKQALGLWSEFGVHLGCAIKAVMYVFDPEAIILGGSIAKAYPLFKAGML
EALNDFAYPQSLKRLKIMQSQDDTISLLGAAALVSQEVKVKV
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgacaataggtgtagatttaggggggacaaaaataaaagcgggtatcgaaaaaaacggt
tcgatcatccaccagaacactatatttctccgacaaaaggaatcattatcggctacatta
agtcaattgattgacctgatcaaaccgctgacccattatcccgccaccggtatcggcatt
ggcgtgccatcggtggtggataccgaacgcggtatcgtgtacaacgtagccaatatcccc
tcgtgggaaaaagtagccctgcgggatattttggaagaagaattcaacctgcccgttttt
gtcaacaatgacgtcaattgctttacgttgggtgaacaccgtttcggcgtagccaaagac
tttgattcggtggtcggaatgaccatcggaacaggacttggctcgggtattatcattgac
aatcagctctataccggtcataactgcggcgcgggagaaatcggcatgctcccctaccgc
gaccataattttgagtattatgcctgcagcaatttcttcgatggcatccatggcacaagt
gcgctggaagccagtcatgcagcagtggcaggcgataaacaggcccttggtttatggtca
gaattcggagtgcatttaggctgcgccatcaaggccgtcatgtacgtatttgacccggaa
gccattatcttgggggggtccattgccaaagcttaccctttgtttaaagcgggcatgttg
gaagccctcaatgattttgcctatccgcaatcactcaaacgcctcaaaataatgcaatct
caagacgacaccatttcactgttgggtgccgccgccttagtttctcaagaggtaaaggtc
aaggtctga

DBGET integrated database retrieval system