KEGG   Runella slithyformis: Runsl_2885Help
Entry
Runsl_2885        CDS       T01553                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rsi  Runella slithyformis
Brite
Enzymes [BR:rsi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Runsl_2885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3358282..3359364)
Genome map
AA seq 360 aa AA seqDB search
MKKSLIIGISFGIWAWAACNRTPNPLTPVGPDPSGDKIEVPQPSYFPMKVYDLTTNPVTL
NGFLLGKSLFYDGILSRNGTIACGTCHQQAAAFTHHGHDLSHGIDDRLGTRNAPSLQNLA
WSREFFWDGGVPHLDLFSIAPIENPVEMDEKMPNVLQKLRTGKNPDYPELFKKAFGSTEI
TTERFSKALSQFMLLMVSNNSRYDIYLRGTANALTATEKEGLTIFRQKCGSCHTGELFTD
QSYRNNGLSIDRNPDQGRFNITQNPDDRHKFKVPSLRNVGLTAPYMHDGRFTTLEQVLDH
YAQNVKQTPNLDGLLLNDGKLGISLTADEKQKIIAFLKTLSDEQFVQDTRFSDPGFGHSF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatcattgatcatcggaatctcctttggaatttgggcgtgggcagcgtgtaat
cgcacgcccaatcccctaacgcccgttggccccgacccttccggagataaaatagaggtt
ccgcaaccgagctattttccgatgaaggtctatgatctgacaaccaatcctgtaacctta
aatggttttctactggggaaatcgttgttttatgacggaattttatcgcgcaacggcacc
attgcctgcggcacctgccatcagcaagcggccgcttttacccaccacggccacgatctc
agccatggcatcgacgacaggctcggaacacgcaatgcgccttccctccaaaatttagct
tggtccagggaatttttttgggacggcggcgtgccacatttagaccttttttcgattgcg
cccattgaaaatcccgttgaaatggacgaaaaaatgcccaacgtattacagaaactgcgc
accggcaaaaaccccgattatcccgaacttttcaaaaaagcctttggcagtaccgagatt
accactgagcgattcagcaaggccctgtcgcaatttatgctgctgatggtttccaacaat
tcacgctacgatatttatctgcgaggtactgctaacgcgctcactgctaccgagaaagaa
ggtcttacgattttcagacaaaagtgcgggagctgccatacgggcgaattatttaccgac
caaagctaccgaaacaacggcttgagcattgaccgaaatcccgaccaagggcgtttcaac
atcacccaaaaccccgatgaccgacataaatttaaagttccgagcttgcgaaatgtaggg
ctcacggccccttacatgcacgacggccgttttacaacgcttgagcaggtattggaccat
tatgcacaaaatgttaaacaaacacccaaccttgatggtttactactgaatgacggaaaa
ttgggaatttcgctgacggcagatgaaaagcaaaaaatcattgcatttcttaaaacactt
tctgacgagcaattcgtacaggacactcgtttttctgaccccggattcgggcattccttt
taa

DBGET integrated database retrieval system