KEGG   Runella slithyformis: Runsl_2900Help
Entry
Runsl_2900        CDS       T01553                                 

Definition
polyprenyl synthetase
Orthology
K13789  
geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
rsi  Runella slithyformis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:rsi00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3374508..3375485
Genome map
AA seq 325 aa AA seqDB search
MTFQPYLEAISTQIQHTAYGEEPTELYEPIRYIMSLGGKRLRPLLTVLSANLFIDDWQKA
LKPAIAVEVFHNFTLMHDDIMDCAPLRRGKPTVHEKWNANTAILSGDVMLVNAYELLLDV
APAQLPRVIKRFNRTAAEVCEGQQLDMNFETRTDVSQEEYIGMIRLKTSVLLGFAMELGG
IIAGADEATTQLLYDAGVNMGLGFQLKDDLLDVYGDPEKFGKQVGGDIIANKKTFMLIEA
LLLAEGKTKEALNYWLSLEQGSYDTAAKVAAVTDIYTQLGLDKIAQTLADAYFAKGFEAL
ENLPIAPERKRPIMEFAAFLVGRES
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgacttttcaaccttatctggaagcgatttcaacccaaattcaacatactgcttacggc
gaggagcctaccgaattatatgagcctatccgttatatcatgtcgttggggggcaagcgt
ttacgccctctgctgactgttttgtcggccaatcttttcatagatgactggcaaaaagcg
cttaagccggccattgcggtggaggtttttcacaattttaccctgatgcacgacgacatc
atggactgtgcgccgctgcgacgcggcaaacccaccgtgcatgagaaatggaacgccaat
acggcgattttatcgggtgatgtgatgctcgtcaatgcctatgaattattgctggatgta
gcaccggcacagttgccgcgtgtcattaagcgtttcaatcgtacggcggcagaagtctgc
gaaggccagcagctggatatgaactttgaaacccgcacggatgtgtcgcaggaagaatac
atcggcatgattcgcctcaaaacgtcggttttgctggggtttgcgatggagttgggtggt
atcattgcgggagcagatgaagccaccacgcaattgctttacgatgccggcgtgaacatg
gggctgggctttcagttaaaagatgacctgttggatgtatacggcgatcctgagaagttt
ggaaagcaggtagggggggatatcatagccaacaaaaaaacctttatgcttatagaagcg
cttctgctggccgaaggcaaaaccaaagaagcactcaattactggcttagtttggagcag
ggctcgtacgataccgccgctaaagtagccgccgtgactgatatttatacccaactcggc
ctcgacaaaattgcccaaaccctggccgatgcgtattttgcaaagggatttgaagcgctg
gagaatctccccattgcgccggagcgcaaacgaccgatcatggaatttgccgcgtttttg
gtggggcgggagagttaa

DBGET integrated database retrieval system