KEGG   Runella slithyformis: Runsl_2900Help
Entry
Runsl_2900        CDS       T01553                                 

Definition
polyprenyl synthetase
Orthology
K13789  
geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
rsi  Runella slithyformis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Runsl_2900
Enzymes [BR:rsi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     Runsl_2900
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     Runsl_2900
    2.5.1.29  geranylgeranyl diphosphate synthase
     Runsl_2900
Prenyltransferases [BR:rsi01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Runsl_2900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3374508..3375485
Genome map
AA seq 325 aa AA seqDB search
MTFQPYLEAISTQIQHTAYGEEPTELYEPIRYIMSLGGKRLRPLLTVLSANLFIDDWQKA
LKPAIAVEVFHNFTLMHDDIMDCAPLRRGKPTVHEKWNANTAILSGDVMLVNAYELLLDV
APAQLPRVIKRFNRTAAEVCEGQQLDMNFETRTDVSQEEYIGMIRLKTSVLLGFAMELGG
IIAGADEATTQLLYDAGVNMGLGFQLKDDLLDVYGDPEKFGKQVGGDIIANKKTFMLIEA
LLLAEGKTKEALNYWLSLEQGSYDTAAKVAAVTDIYTQLGLDKIAQTLADAYFAKGFEAL
ENLPIAPERKRPIMEFAAFLVGRES
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgacttttcaaccttatctggaagcgatttcaacccaaattcaacatactgcttacggc
gaggagcctaccgaattatatgagcctatccgttatatcatgtcgttggggggcaagcgt
ttacgccctctgctgactgttttgtcggccaatcttttcatagatgactggcaaaaagcg
cttaagccggccattgcggtggaggtttttcacaattttaccctgatgcacgacgacatc
atggactgtgcgccgctgcgacgcggcaaacccaccgtgcatgagaaatggaacgccaat
acggcgattttatcgggtgatgtgatgctcgtcaatgcctatgaattattgctggatgta
gcaccggcacagttgccgcgtgtcattaagcgtttcaatcgtacggcggcagaagtctgc
gaaggccagcagctggatatgaactttgaaacccgcacggatgtgtcgcaggaagaatac
atcggcatgattcgcctcaaaacgtcggttttgctggggtttgcgatggagttgggtggt
atcattgcgggagcagatgaagccaccacgcaattgctttacgatgccggcgtgaacatg
gggctgggctttcagttaaaagatgacctgttggatgtatacggcgatcctgagaagttt
ggaaagcaggtagggggggatatcatagccaacaaaaaaacctttatgcttatagaagcg
cttctgctggccgaaggcaaaaccaaagaagcactcaattactggcttagtttggagcag
ggctcgtacgataccgccgctaaagtagccgccgtgactgatatttatacccaactcggc
ctcgacaaaattgcccaaaccctggccgatgcgtattttgcaaagggatttgaagcgctg
gagaatctccccattgcgccggagcgcaaacgaccgatcatggaatttgccgcgtttttg
gtggggcgggagagttaa

DBGET integrated database retrieval system