KEGG   Runella slithyformis: Runsl_3004Help
Entry
Runsl_3004        CDS       T01553                                 

Definition
2-oxoglutarate dehydrogenase E2
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rsi  Runella slithyformis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Runsl_3004
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Runsl_3004
  Amino acid metabolism
   00310 Lysine degradation
    Runsl_3004
Enzymes [BR:rsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Runsl_3004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3500026..3501618
Genome map
AA seq 530 aa AA seqDB search
MSQIEIKVPTVGESITEVTIGSWVKKDGESVKRDEVICSLDSDKASFDVVSEADGVLQIK
AQEGDVLPIGGLICVVETSATATSAPAPAPVTSAPAQAPAPAASSAPAPAAAAKVVEMKV
PTVGESVTEVTISSWSKKDGDTVQLDEVLCELESDKATFELPAEAAGVLRIVAEAGATLP
IGAVICKIEVGAGSSAAPQPAAEAPAAAPPSNGQATAANASNDSYAAGHPSPAAAKILAE
KGIDPASVSGSGVGGRLTKEDAVAAQPKAAPTAAPAEQPKAPVAAPAASAPAPKAPDARG
QRRVKMTSLRKTIARRLVAVKNETAMLTTFNEVDMKPIMELRNKYKDKFKEKHGVGLGFM
SFFTRACAVALQEFPVVNAFIDGDEVVYNDFSDISIAVSTERGLVVPVIRNAEKMTFSQI
EKEIIRLAGLARDNKLTIDQMQGGTFTITNGGIFGSMLSTPIINAPQAAILGMHNIVERA
VVVNGEIVIRPIMYVALSYDHRTIDGRDSVSFLVRVKQLLEDPTRLLLEV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaattgaaataaaagtccctaccgtcggcgaatcgatcactgaagtaaccatt
ggttcctgggtgaaaaaagacggtgaaagtgtcaaacgtgatgaagtaatatgtagctta
gattccgataaagcgtcatttgacgtggtttctgaagcggatggcgttttgcaaattaaa
gctcaggaaggtgatgtattaccgattggtggattgatatgtgtggttgaaacatcggcg
acagcaacttccgctcctgcacctgctccggtcacttctgctcccgcacaggcccctgcc
ccggcggcatcttcagcccctgctcccgctgctgcggctaaagtggtggaaatgaaagtg
ccgacagtgggtgaatctgtgacggaagtgaccatctcaagctggagtaaaaaagacgga
gataccgttcaactggacgaagtactctgcgaattggaatctgacaaagcaacgttcgaa
cttccggccgaagccgcgggtgtattgcgcattgtggccgaagcgggtgctacgcttccc
atcggcgcggtgatctgtaaaattgaagtaggggcaggaagttcggccgctcctcagccc
gccgctgaagcgcctgctgccgctcctccatccaacggacaggccactgcggccaatgcc
tccaatgacagctatgccgcaggacatccttcgccggcggcggctaaaattttagccgaa
aaaggaatcgaccccgcaagtgtatcgggctccggcgttggcggacggttaaccaaagaa
gatgcggtagccgctcaacccaaagcagccccaacggccgctcctgccgaacagcccaaa
gctccggtggccgccccggccgcaagcgctcctgctcccaaagcacctgatgcccgcgga
caacgccgtgtaaaaatgacctctttacgcaagaccatcgcccgtcgcctggtagccgtt
aagaatgaaacggccatgttgacgaccttcaacgaggtagacatgaagccgatcatggag
ttgcgcaataaatacaaagataaatttaaagaaaagcacggcgtcggcttgggctttatg
tcgttctttaccagagcctgcgcagtggctttgcaggaatttccggtagtcaatgctttt
attgacggcgacgaagtcgtttacaatgatttctccgatatttcgattgccgtttcgacc
gagcgcggattggtggtgcccgtgattcgtaatgccgagaaaatgaccttctctcaaatt
gagaaagagatcattcgtttggccggacttgcccgcgacaataagctgaccattgaccaa
atgcagggcggtacgtttaccatcaccaacggcggtattttcggctcgatgctttcgaca
cccatcatcaatgcccctcaggcggcgattttgggaatgcacaacatcgtagagcgtgcc
gtggtcgtaaacggagagattgtgattcgacccattatgtacgtagcgctcagttatgac
caccgcaccatcgacggtcgcgattcggtaagcttcctcgttagagtgaagcaattgctc
gaagaccccacccggttgttgctggaagtgtaa

DBGET integrated database retrieval system