KEGG   Runella slithyformis: Runsl_3042Help
Entry
Runsl_3042        CDS       T01553                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rsi  Runella slithyformis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Runsl_3042
Enzymes [BR:rsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Runsl_3042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3540377..3540865
Genome map
AA seq 162 aa AA seqDB search
MNEHSVFLLLGANLGEREAMLAKAARLIAERIGLIKAQSHLYETAPWGMIDQPAFLNQVL
EVKTALLPEAVLVQTLEMEKQLGRERRMRWGARVIDIDMLYFAGVILETEALHLPHPRLH
QRRFTLVPLAEIAPDFMHPVLHKTNQQLLCECTDDSQVSVCE
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacattcggtttttttattgctgggtgccaatttgggcgagcgggaagcgatg
ttggcaaaagcggcccggttgatcgcagagcgaattggtctgattaaggcacagtcgcat
ctgtatgaaacagccccttggggaatgattgaccaacctgcttttttgaatcaggtcctt
gaagtaaaaaccgcactgctgcccgaagcggttttagtacaaacgctggaaatggaaaaa
cagcttggacgagaacgacgtatgcggtggggcgcacgggtcattgacattgatatgctg
tattttgccggggtgatcttagaaacggaagcgctgcatttgccccatccgcgtttgcac
caacggcgttttacgctggtgcctttggccgagatcgcccccgattttatgcatccggtg
ttgcataaaacaaaccaacaattactctgtgaatgtacggatgatagtcaggtcagcgtt
tgtgaataa

DBGET integrated database retrieval system