KEGG   Runella slithyformis: Runsl_3113Help
Entry
Runsl_3113        CDS       T01553                                 

Definition
chemotaxis protein CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rsi  Runella slithyformis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Runsl_3113
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Runsl_3113
Enzymes [BR:rsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Runsl_3113
Two-component system [BR:rsi02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Runsl_3113
Bacterial motility proteins [BR:rsi02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Runsl_3113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3635975..3636562
Genome map
AA seq 195 aa AA seqDB search
MAEVKMNVPCELIVIGGSSGSIEVLLKLLPSLKAPLSLALILVLHRKNSVESTMVELFSG
RTNIPVKEVEDKDPVEPGIIYIAPADYHLLIEQDRAFSLDSSEKINFSRPSLDVTFESAA
EVYGPSLVGVILSGANADGTLGLKAVKRAGGLIIAQKPETAQVAYMPEQAILHNTIDFIF
DISELATFINSSLNR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagttaagatgaacgtcccctgtgagctcattgtcattggaggctcatcggga
agtattgaagtgctgctcaaattattgccgagcctgaaagccccgctgtcgttggcgctc
attttagtgctgcatcgtaaaaactccgtagagtcgaccatggtcgaacttttttcggga
agaacgaacatccccgtgaaagaagtagaagataaagaccccgtcgagcccggcatcatc
tacattgctccggcagattatcacctgctgattgaacaggatcgcgcgttttcgttggac
agttccgaaaaaataaatttcagccgcccgtcactggatgttacctttgagtcggcggcc
gaagtatatggtccatcgttggtcggtgtgatattgtcgggagccaatgccgacgggacc
ctcggactgaaggcggtcaagcgggcaggggggcttatcatcgcgcaaaagcccgaaacg
gcccaagttgcttatatgcccgaacaggcgattttgcacaacaccatagattttattttt
gacattagcgaattggcaacgtttatcaattcatccctaaatcgatag

DBGET integrated database retrieval system