KEGG   Runella slithyformis: Runsl_3113Help
Entry
Runsl_3113        CDS       T01553                                 

Definition
chemotaxis protein CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rsi  Runella slithyformis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rsi02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rsi02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3635975..3636562
Genome map
AA seq 195 aa AA seqDB search
MAEVKMNVPCELIVIGGSSGSIEVLLKLLPSLKAPLSLALILVLHRKNSVESTMVELFSG
RTNIPVKEVEDKDPVEPGIIYIAPADYHLLIEQDRAFSLDSSEKINFSRPSLDVTFESAA
EVYGPSLVGVILSGANADGTLGLKAVKRAGGLIIAQKPETAQVAYMPEQAILHNTIDFIF
DISELATFINSSLNR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagttaagatgaacgtcccctgtgagctcattgtcattggaggctcatcggga
agtattgaagtgctgctcaaattattgccgagcctgaaagccccgctgtcgttggcgctc
attttagtgctgcatcgtaaaaactccgtagagtcgaccatggtcgaacttttttcggga
agaacgaacatccccgtgaaagaagtagaagataaagaccccgtcgagcccggcatcatc
tacattgctccggcagattatcacctgctgattgaacaggatcgcgcgttttcgttggac
agttccgaaaaaataaatttcagccgcccgtcactggatgttacctttgagtcggcggcc
gaagtatatggtccatcgttggtcggtgtgatattgtcgggagccaatgccgacgggacc
ctcggactgaaggcggtcaagcgggcaggggggcttatcatcgcgcaaaagcccgaaacg
gcccaagttgcttatatgcccgaacaggcgattttgcacaacaccatagattttattttt
gacattagcgaattggcaacgtttatcaattcatccctaaatcgatag

DBGET integrated database retrieval system