KEGG   Runella slithyformis: Runsl_3458Help
Entry
Runsl_3458        CDS       T01553                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
rsi  Runella slithyformis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Runsl_3458
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Runsl_3458
Enzymes [BR:rsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Runsl_3458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4033658..4036192
Genome map
AA seq 844 aa AA seqDB search
MIRFLFPALLLVSTFLQAQLTAPSLKISWEIIENNHQGKTASLTAFTLTNTGKKPLPKSG
WTMYFNFVRKVDTTLSNEVKIKHINGDLFQLLPAAAFQGLKAGASMQVSFISEAWVVNFT
DAPAGLYWVWDQQPDKGFALTDYTLKPSTQPRQYQRFAGDNSGLITPAVTYVQNKAIEDI
PANELPKILPSPQHYRETGASFSITPQTTVFAPAELKEEAAFLTAQLTSMMGVPMASTTL
QSGAGVTFQLDSSLLKEAYRLTVNGKGVVIAASERAGAFYAVQSLLALLPPSSWGKTQAS
LSVPGVDVSDQPRFGHRAIMLDVARNFHSKKQLLKLLDLMGFYKLNVLHLHFSDDEGWRL
EIPALPELTQVGAARGHSAVPLKHLPPAYGSGPDISGEAGSGYYSRLEFIEILRYAAARH
IKVIPEIEAPGHARAAVKAMEARYTAKLTEGLKAEAEKYLLHDPADRSVYRSVQMYNDNV
INVAMPSAYRFLETVTDAILGMYREAGAPLETIHYGGDEVPAGVWSKSPAVEKLRQQNPE
LKTTDDLWYYFYGKINDMVQKRGLFLYGWEEIAMRKTMLDGKSHIIPNPDFVGQDMQVDV
WNNVLGWGAEDLAYRLANAGYKVVLSCVTHLYFDMAYHKSFDEPGYYWGAYTDVDKPFSF
IPYDYFKNSKEDRLGNPLDRSIFNGKERLTDYGKQNIVGIQGLVWSETVNSPGRMEYMLL
PKLMGMAERAWAPSPAWAETNDEKAYQKAWSIFANQLGKRELPRLDAFAGGFAYRLPNAG
AIVEGDRVKANVQLPGLTIRYTTDGSEPTANSVVYSQPLPVSKNLKMKVFGVNGRAGKTV
EVNP
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtttcttatttccggctcttttattggtttctacgtttttacaggcccagctg
acggctccgtcgttaaagatcagttgggagatcatcgaaaataaccatcagggaaaaacg
gcgtcactgaccgcgtttacactgaccaatacgggcaaaaagccattgccgaaaagcggc
tggacaatgtacttcaattttgtacgaaaagtagataccaccttatcaaacgaggtgaaa
atcaaacatatcaacggagacctgtttcaactgttgcctgcggccgcttttcagggcctc
aaagcgggggcttcgatgcaggtaagttttatatcggaagcttgggtcgtcaattttacg
gatgcaccggcgggcctgtattgggtttgggaccaacaacccgataagggctttgcgctg
accgattataccttaaaaccttccacacaacctcgtcaataccaacgttttgcgggcgat
aattcgggcctgatcacgcctgctgtgacctacgttcaaaacaaagccattgaggatatt
cccgccaatgaactgccgaagattctcccgagtccgcaacattaccgcgaaacgggggct
tccttttcgatcactccgcaaacgacggtgtttgcacccgctgaattgaaagaagaggcc
gcttttctgacggcgcaattgacctccatgatgggggttccgatggcttcgactaccctt
caatccggcgcaggagttacgtttcagcttgacagcagtcttttgaaagaagcctatcgg
ctgacggtcaacgggaaaggcgttgtcatcgctgcctccgaacgtgcgggggctttttat
gcggtgcaatcattgctggcgttattgcctccttcatcgtggggaaaaacccaggcgagt
ctgtcggtgccgggggtggatgtcagcgatcaaccgcgtttcggccaccgggccattatg
ttggacgtggcccgtaattttcactccaaaaagcaactgctcaaactcctcgacctgatg
ggtttttataaactcaatgtgcttcatttacacttttcagacgatgaaggctggcgattg
gaaattccggcattgcccgaactgacgcaggtaggcgctgcacgcggacattccgctgtg
ccccttaaacacctgccgcctgcctacggctcggggccggatatcagcggtgaggcaggc
tcgggctattacagccgattggagtttatcgaaatactgcgctatgctgccgcccgtcac
attaaagtcattcccgagatcgaagcccccggccacgctcgggcggcggtcaaggcgatg
gaagcacggtatacggccaaactcaccgaaggcctgaaagctgaagcggaaaaatacctc
ctgcacgaccccgccgaccgctcagtgtaccgttcggtgcagatgtacaacgacaatgtg
atcaacgttgcgatgccttctgcctatcgttttctggagaccgtgaccgatgccatctta
ggcatgtaccgtgaagccggggcaccgctcgaaacgatccactacggcggtgatgaagtg
ccggcgggcgtatggtcaaaatcgccggcggtcgaaaagctgcgccaacaaaatcctgaa
ctcaaaaccacggatgacctttggtattatttctacggaaaaatcaacgacatggtacaa
aaacggggactgtttttgtacggctgggaagagatcgccatgcgaaaaacgatgctcgac
ggcaaaagccacatcatccccaaccccgattttgtggggcaggatatgcaggtcgatgtg
tggaataatgtgttgggatggggagccgaagacttggcgtaccgactggccaacgcgggc
tataaagtggtactttcgtgtgtgacgcacctgtattttgacatggcttatcacaaatcg
tttgacgagccgggctactattggggagcgtataccgatgttgacaagccgttttcgttt
attccctacgactatttcaaaaattccaaagaagaccgcttaggcaaccccctcgaccgc
tctattttcaacggcaaagagcggctcaccgactacgggaaacagaatattgtgggtatt
caggggctggtctggagcgaaacggtcaactcgcccgggcggatggaatacatgctgctg
cccaagctgatgggtatggccgaacgcgcctgggcaccttcacccgcctgggccgaaacc
aacgacgaaaaagcttaccaaaaagcatggtcgatttttgccaatcaactgggcaaacgc
gaactcccgcggttggatgcgtttgcgggcggctttgcgtatcgcctgccgaatgcgggg
gctattgtcgaaggtgaccgggtgaaagccaacgttcaattgcccggcttgaccattcga
tacacgacagacggctccgagcctaccgctaacagcgtggtgtattcacaacctttaccc
gtgagcaaaaacctcaagatgaaggtgtttggtgtcaacggccgcgccgggaaaaccgtt
gaagtaaatccctga

DBGET integrated database retrieval system