KEGG   Runella slithyformis: Runsl_3516Help
Entry
Runsl_3516        CDS       T01553                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rsi  Runella slithyformis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Runsl_3516
Enzymes [BR:rsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Runsl_3516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4092492..4093274
Genome map
AA seq 260 aa AA seqDB search
MSETILMQQDRLNKVESILVTQARPTDEKSPYFELERRYNLKVDFRPFIEVQGISFKDFR
KQRINIMEHTAIIFTSRNAVDHFFRICKEAKLEMPAEMKYFCVTEQTANYLQKYIQIRKR
KIFAGQKTAADLLDLIKKHKTEKFLFPCSDKRRNDIPEFMGNYELHLTEAVMYETVSSDL
SDLTEVFYDIICFFSPSGITSLFHNFPDFKQNKTRIAAFGPTTAKAVSEAGLILDIEAPM
PNAPSMTGALEIYIKKSNNI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaacgattttgatgcaacaagaccgattgaataaagtagagagcattttggtt
acgcaagctcggccaactgatgaaaaatccccttattttgagttggagcgcaggtacaat
ctaaaggttgattttcgcccttttatcgaagtgcagggtatttcgttcaaagatttccgc
aagcagcgaatcaatattatggagcatacggccattatattcaccagccgtaatgccgtt
gatcatttcttccgtatctgtaaggaagcaaagttggagatgcccgctgaaatgaaatat
ttttgtgtgaccgagcaaactgccaactatctgcaaaaatatatccaaatacgtaaacgg
aagatttttgccggtcaaaaaacggcggcagatttattggatctgattaagaagcacaaa
accgagaaatttttgtttccctgctccgataaacgtcggaatgatatccctgaatttatg
ggtaattatgaactgcacctcacggaagcggtaatgtatgaaacggtatcttcagactta
tccgatttgacggaagtattttatgatattatctgtttcttcagcccctccggtattacg
tcattattccataattttcctgactttaaacaaaataaaaccagaatagccgctttcggt
ccaaccactgccaaagctgtttcagaggcaggattaatattagacattgaggcacccatg
cccaacgcaccctccatgaccggagcacttgaaatttatatcaaaaaatcaaataatatt
taa

DBGET integrated database retrieval system