KEGG   Runella slithyformis: Runsl_3564Help
Entry
Runsl_3564        CDS       T01553                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
rsi  Runella slithyformis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rsi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4141585..4142190
Genome map
AA seq 201 aa AA seqDB search
MNFPSKLIEQAVGEVSKLPGIGKKSALRIVLHLLKRSENETQSLADALVAVRTQIQYCRK
CHNISDSELCSICLSPKRDASVVCVVQDSRDVLAIENTGQYTGLYHVLGGIISPLEGVSP
GDLKIESLLQRLKHAPEVREIILALSPTMEGDTTSFYLQKKLRPFSLKISTIARGIPIGG
DLEYADEITLGRSIVSRINYD
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaattttccctcaaaattaatagaacaggcggtaggtgaagtgtcaaagctgccgggc
attggtaaaaaaagtgctttacggattgtacttcacttactcaaacgtagtgaaaacgaa
actcagtcgttggctgacgcgttggtggcagtccgaacccaaattcagtactgtcgaaaa
tgtcataatatttcagacagtgagctgtgcagcatctgtttaagccccaaacgcgatgcc
tcggtggtctgtgtcgtacaggatagccgtgatgtgctggccatcgaaaacaccgggcag
tataccggcctttatcacgtacttggaggaatcatttcaccccttgagggggtcagtccc
ggcgatttaaaaatagaatctcttctgcaacggcttaaacatgcccctgaagtcagggaa
attatactggccctcagtccgacgatggaaggtgatacaacttccttttatctgcaaaaa
aagctaaggccgttttcgttgaaaatttcaactattgcccgcggtatccccatcggtggg
gatcttgaatacgccgatgaaatcacattgggtcgaagtatagtgagtagaatcaattac
gattag

DBGET integrated database retrieval system