KEGG   Runella slithyformis: Runsl_3741Help
Entry
Runsl_3741        CDS       T01553                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rsi  Runella slithyformis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Runsl_3741
Enzymes [BR:rsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Runsl_3741
Exosome [BR:rsi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Runsl_3741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4332258..4333757
Genome map
AA seq 499 aa AA seqDB search
MSKYVAAIDQGTTSTRCIIFDRQGNIISVGQKEHQQIYPQPGWVEHNPDEIWKNTLEVIA
GARINGSIAASDIAAVGITNQRETTAVWNRRTGKPYYNALVWQDTRTGDLVNQFAREGGQ
DRFRAQTGLPLATYFSGLKLKWLLDNVPGLREDAEKGEALFGTMDTFLIWHLTGGIHGGT
HVTDVTNASRTQLMNLQTLAWDPEMLAAFEIPRLMLPLIKSSSEVYGSVVLDVLPNVPIA
GDLGDQHAALVGQTCFEPGQAKNTYGTGCFMLLNTGTEMKVSTQGLLTTVAYKFGNDPVN
YALEGSVAISGALVQWLRDNLGMIEKSSDVETLAKSVEDNGGAYFVPAFSGLYAPYWKAD
ARGVIAGLTRYVTKAHIARAVLEATAYQTLDVMKAMEKDADIQLKSLRVDGGMVANETLM
QFQADMLDVPVVCPAVTETTALGAAYAAGLAVGYWKNFDDLRLNWGIAHTWDPKMGSTQR
NKLHKGWLKAVERSFGWED
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaatacgtagctgccattgatcagggtactaccagtactcgttgtattatcttt
gaccgtcagggaaacatcatttctgtcgggcaaaaagaacaccaacagatctatccccag
ccggggtgggttgaacataatcctgatgagatttggaaaaatacgcttgaagtgattgcc
ggggcgcgaatcaatgggtcgattgccgctagtgatattgcggcggttggaatcacgaac
caacgcgaaacgaccgctgtctggaatcgtcgcaccggaaaaccttactataatgcgctt
gtctggcaagatacccggaccggtgatctggtcaaccaatttgcccgagaaggcggtcag
gaccgtttccgtgcccaaaccggattgcccttggctacgtacttcagtgggttaaaactc
aagtggctcttggataatgtaccgggcctgcgggaagatgccgagaaaggcgaagcactt
tttggtaccatggatacctttctgatctggcatctgaccggtggaattcatggcggaacg
cacgttacggatgtaaccaacgccagccgcacgcaactgatgaatcttcagacgttggcc
tgggaccccgagatgttggcggcgtttgaaattccgcgactgatgctgcccctcatcaaa
agcagcagcgaagtgtacggaagcgttgtgctggatgtattgcccaatgtaccgatcgcc
ggcgatttgggtgatcaacacgctgccttggtgggacaaacgtgctttgagcccggtcag
gcaaaaaatacctatgggacgggctgctttatgcttcttaatacgggtacagaaatgaag
gtctccacgcagggactgcttactacggttgcgtacaaatttggcaatgatccggtcaac
tatgccctcgaaggaagtgttgccatttcgggtgcgttggtccaatggttgcgcgacaac
ctgggtatgatcgagaaaagcagcgacgtggaaacgttggctaaatcagtcgaggataac
ggcggtgcctattttgttcctgctttttcgggtttatatgcgccttattggaaggccgac
gcccggggagtgattgccggcctgacgcgctatgtgaccaaagcgcacattgcccgggca
gtgctggaagccacggcctatcaaacactggatgtaatgaaagcgatggaaaaagatgct
gatatccaactgaaatctctccgcgtagacggcggtatggtggccaatgaaacgctcatg
cagtttcaggcagatatgctcgatgtgccggtggtgtgccctgcggtaaccgaaacaacg
gcactgggcgcggcctatgcggccggattggcggtaggctattggaagaattttgatgat
ttgcgtttgaattggggcatcgctcacacttgggacccaaaaatgggaagcacgcaacga
aataagttgcacaaaggctggctaaaagcggtagaacgctctttcggctgggaagactga

DBGET integrated database retrieval system