KEGG   Runella slithyformis: Runsl_3810Help
Entry
Runsl_3810        CDS       T01553                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
rsi  Runella slithyformis
Pathway
rsi00340  Histidine metabolism
rsi01100  Metabolic pathways
rsi01110  Biosynthesis of secondary metabolites
rsi01230  Biosynthesis of amino acids
Module
rsi_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Runsl_3810
Enzymes [BR:rsi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Runsl_3810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh DUF885
Motif
Other DBs
NCBI-ProteinID: AEI50168
UniProt: F8EM68
Position
4399149..4400417
Genome map
AA seq 422 aa AA seqDB search
MQIIPYPDRSEWAALLARPTQSMANIEKAVAPILEQVQKEGDAALRALALKFDKIDLAEI
AMPLETVAAAETSLTEELKAAIRQAYANIRKFHEAQYQPAEKIETMPGVTCWRRSVGIEK
VGLYIPGGSAPLFSTVLMLGVPAQLAGCKEVVLCTPSDHPAILYAAQLVGVTKIFRIGGA
QAIAAMAYGTESVPKVYKIFGPGNQYVTAAKMLLAKEGVAIDMPAGPSEVAIYADGSAVP
SFVAADLLSQAEHGADSQVLLVSTDKKFLASVNLTLATQLEGLPRKELARKAIENSKAIL
VEDEAEAIDLLNEYAAEHLILSVQNAEALSEKIINAGSVFLGNYTPESCGDYASGTNHTL
PTNGHARAYSGVSLDSFVKKITVQHITPEGLKALGPTVEAMAEAESLYAHKRAVSLRLSS
LK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattatcccttaccccgaccgcagtgaatgggctgcgcttttagcccggccgaca
cagagcatggccaatatcgaaaaggccgttgcccctattctggaacaggtgcagaaagaa
ggcgatgccgcgttgcgcgcgttggcgctgaaatttgataaaattgatcttgccgagatc
gcgatgccgctggaaacggtggcggccgctgagacaagtttaaccgaagagctcaaagcg
gcgattcggcaggcttatgccaatattcgaaagtttcatgaggcgcagtatcagcccgct
gaaaaaattgaaactatgcccggggttacctgctggcggcgcagcgtaggcattgaaaag
gtaggcttatacattcccggcggttcggctccgctgttcagtacggtgctgatgctgggc
gtcccggctcaattggccggctgtaaagaggttgttctctgtacgccgagcgaccacccc
gccattttgtacgcggcacaattggtgggtgttacgaagattttccgtatcggcggtgcg
caggctattgcggccatggcctacggaaccgaatccgttcctaaagtctacaagatattc
gggccgggcaaccaatacgttacggcggcaaaaatgctgttggcgaaagagggcgtggcc
attgacatgccggcgggtccctcagaagtggcgatttacgcggacggatcggcggtaccg
tcgtttgtggcggccgatctgttgtcgcaggcagagcatggagccgacagccaggtgctg
ctggtatcgacagataagaaatttttagcttcggtaaaccttacgcttgctacgcaattg
gaaggcctgccccggaaagaattggcgcgaaaggcgattgaaaacagcaaagcgatcctg
gtggaagatgaagccgaagccattgacctgctcaatgagtatgcggcagaacacctgatc
ctgagtgtgcagaatgccgaagccctcagtgaaaagatcatcaatgccggctctgttttt
ctgggaaattatacccccgaatcctgcggagattatgcctcgggcaccaatcacaccctg
ccgaccaacggccacgcccgggcgtacagcggagtatcgttggatagtttcgtaaaaaag
atcaccgtccagcacatcacgcctgaaggtctcaaagctctgggaccgacagtcgaggcc
atggccgaagccgagtcgctctacgcgcataagcgtgccgtaagcttgcgtttgagcagt
ttgaaataa

DBGET integrated database retrieval system