KEGG   Runella slithyformis: Runsl_3880Help
Entry
Runsl_3880        CDS       T01553                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
rsi  Runella slithyformis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Runsl_3880
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Runsl_3880
Enzymes [BR:rsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Runsl_3880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4485597..4487261
Genome map
AA seq 554 aa AA seqDB search
MTFMKKRVFFLFSFLFWAISPVFSQNFYPILPKPLVLEPKEGTFILPPNPVIAVAGTDPV
LRRLAEELAHRIGTAAGKDTKVFAGNFRVRDGINFVTGKDAKLGEEGYLLEITPKRIVIT
AEQPKGFFYGLQSLLQLMPAEIYGSVRAENIPWSIPCCYIEDRPRYAYRGLMLDVGRHLY
PVSFIKKFIELIALHKMNVFHWHLTDDQGWRIEIKKYPKLTQIGSQRKETMWGHYSDQKY
DGKPYGGFYTQEEIREVVNFAREHFVTVIPEIEMPGHASAALAAYPEFGNNPDKLYQVGT
KWGVHEDVFAPREETFRFLEDILTEVIDLFPGQYIHIGGDECPKNQWKESRFCQELIRKE
GLRDEYGLQSYFIRRIDRFITSKGRKIIGWDEILEGGISPNATIMSWQGTEGGIAAAKQH
HEAIMTPGNFCYLDHYQADANTQPIAIGGLTTLEEAYSYNPTPAELTPEEAKHILGVQGN
VWTEYMPSSEYVEYMTFPRAIALAEVGWTLPSHKNIDDFKKRLNIHKKRLEYWNVNYFGA
PLNRTFIYQWPSKK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgacctttatgaaaaagcgcgttttctttttgttttcatttctgttttgggctatatcc
cccgttttcagccaaaatttctatcctatccttcccaagccgttagtgctcgaaccgaaa
gagggaacctttattctccctcccaatccggtcatcgccgttgcaggcacagatcctgta
ttgcgccgtttggctgaagaattggcccatcggattggcacggcagcaggaaaggatacc
aaagtatttgccggcaatttccgggtcagagacggtatcaattttgtgaccggtaaagac
gccaaactgggcgaagagggctatttgttggaaattacgccgaagcgaatcgttattacg
gcagagcagcccaaaggtttcttttatgggttgcaatcacttttacaactgatgcctgcg
gaaatctatggatccgtgcgcgctgaaaatatcccatggagcataccctgttgttacatt
gaagatcggccgcggtatgcctaccgcgggttaatgctcgatgttgggcgtcatttgtat
cccgtttcctttatcaaaaagttcattgagttgattgctcttcataaaatgaatgtcttt
cattggcatttgaccgatgatcaggggtggcggatagaaatcaaaaaataccctaaattg
acccaaatcggttcgcagcgaaaagagaccatgtggggacattacagcgaccaaaaatac
gacggtaagccctacggtggtttttatacgcaggaggaaatcagagaggtggtcaacttt
gcccgtgagcattttgtgaccgttattccggaaattgaaatgcccggacatgcgtcggca
gcattggcggcttatcccgaatttggcaacaaccccgataaactctatcaggtaggaaca
aagtggggcgttcatgaagatgtatttgcgcctcgagaagaaacgttccgctttttagaa
gatattctgactgaagtaatcgacctgtttccgggtcagtatattcatatcggaggggac
gaatgtcctaaaaatcaatggaaggaaagccgtttttgtcaggaattgatccggaaggaa
ggactcagggatgagtatgggctgcaaagttattttatccgccgtattgacagattcatt
acgtccaaagggcgcaaaataataggttgggatgaaatattggaaggcggcatttctccc
aatgctaccataatgagttggcaaggcaccgaaggggggattgccgcggcaaagcaacat
catgaggccatcatgactccaggcaatttttgttatttagaccattatcaggccgatgcc
aacactcagccgattgccatcggcggtctgacaacattggaagaggcgtactcatacaat
cccactcctgccgaacttacacctgaagaagctaagcatatccttggtgtgcaggggaat
gtctggacggaatacatgccttcatcagagtacgtagaatacatgacctttccgcgggcg
attgcattggctgaagtgggatggacactcccaagccataaaaatattgatgattttaaa
aaacggctgaacattcataagaaacggttggagtattggaatgtgaattacttcggggca
ccgctcaatcgtacatttatttaccaatggccatcaaaaaaatag

DBGET integrated database retrieval system