KEGG   Runella slithyformis: Runsl_4147Help
Entry
Runsl_4147        CDS       T01553                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rsi  Runella slithyformis
Pathway
rsi00020  Citrate cycle (TCA cycle)
rsi00640  Propanoate metabolism
rsi00660  C5-Branched dibasic acid metabolism
rsi01100  Metabolic pathways
rsi01110  Biosynthesis of secondary metabolites
rsi01120  Microbial metabolism in diverse environments
rsi01130  Biosynthesis of antibiotics
rsi01200  Carbon metabolism
Module
rsi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Runsl_4147
   00640 Propanoate metabolism
    Runsl_4147
   00660 C5-Branched dibasic acid metabolism
    Runsl_4147
Enzymes [BR:rsi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Runsl_4147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 SMC_hinge
Motif
Other DBs
NCBI-ProteinID: AEI50492
UniProt: F8EKK9
Position
complement(4778083..4779309)
Genome map
AA seq 408 aa AA seqDB search
MNIHEYQGKEILKKYGVRIQDGIVVDTPERAVEAYRSIAERTGSKFVVVKSQIHAGGRGK
GKIQGLEQRGVQVAKSPDQVREIATNLLGNVLVTHQTGPEGKKVNKIFLAEDAYYPGASE
PKEFYISILLDRAKGCPVIMASTEGGMDIEEVAEHTPEKIIKEWIDPRVGLQGFQARKIA
FAFGLSGNAFKEMVKFITSLYTAYWESDASMFEINPVLKTSDDKIMAIDAKVDLDDNALI
RHADLAQMRDTNEEDPLEVEAGESNLNYVKLDGNVGCMVNGAGLAMGTMDLIKLSGGEPA
NFLDVGGGANAKTVEAGFRIILKDPNVKAILINIFGGIVRCDRVATGVVEAYKAIGNIPV
PIIVRLQGTNAEEGARIINESGLKVFSAIEFKEAAAKVTEVLKSLGVN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgagtaccaaggaaaggaaatactcaaaaaatacggtgtccgcattcag
gacggaatcgtagttgatacccctgaaagggccgtagaagcctaccgttccattgccgag
cgtacaggttctaaatttgtcgttgtaaaatcgcaaatccacgcgggtggacgcggtaaa
ggtaaaattcagggattggagcaacgcggcgttcaggttgccaaatctcccgaccaagtg
cgtgaaatcgccacaaaccttttgggaaatgtattggtaacacaccaaaccggccccgaa
ggaaaaaaagtaaacaaaatctttttggccgaagacgcttactatcccggagcttctgag
ccgaaagaattttacatttcaattttgctcgaccgtgccaaaggttgccctgtcatcatg
gcaagtaccgaaggcgggatggatattgaggaagtagccgagcatacccccgaaaagatc
atcaaagaatggattgacccacgcgtaggcctgcagggttttcaggcccgcaaaatcgca
tttgcctttggcctttccggtaatgcatttaaagagatggtgaaatttattacttctttg
tacaccgcttattgggagtctgacgcttcaatgtttgagatcaatccggtactgaaaaca
tcggatgacaaaatcatggccattgatgcaaaagtggatttggacgacaatgcgctgatt
cgtcacgcagaccttgcccagatgcgcgataccaatgaagaggatccgttggaggttgaa
gccggtgagagtaaccttaactacgttaaacttgacggaaacgtaggctgtatggtcaac
ggtgccggcttggccatgggaaccatggacttgatcaaactttcaggcggtgagccggcc
aacttcctcgacgtagggggtggtgccaatgccaaaacggtagaagcaggtttccgtatc
attctcaaagacccgaatgtgaaggcgattctgatcaatatctttggaggtattgttcgc
tgcgaccgcgtagccacaggagttgtggaagcttacaaggccatcggaaacattccggtg
cccatcattgtacgtttgcagggaaccaacgccgaagaaggtgcgcgcatcattaatgaa
tcagggttgaaagtattttcggccattgagttcaaagaagcggccgcgaaagtaaccgaa
gtattgaaatcgttaggggtgaactag

DBGET integrated database retrieval system