KEGG   Runella slithyformis: Runsl_4655Help
Entry
Runsl_4655        CDS       T01553                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rsi  Runella slithyformis
Pathway
rsi00260  Glycine, serine and threonine metabolism
rsi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rsi01100  Metabolic pathways
rsi01110  Biosynthesis of secondary metabolites
rsi01130  Biosynthesis of antibiotics
rsi01230  Biosynthesis of amino acids
Module
rsi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Runsl_4655
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Runsl_4655
Enzymes [BR:rsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Runsl_4655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: AEI50974
UniProt: F8EMK3
Position
complement(5364946..5365725)
Genome map
AA seq 259 aa AA seqDB search
MNRIVSLFEQHPTRNLNVYFTAGYPALDDTRRILKALQEAGADLVEIGMPYSDPVADGET
IQISNQQALENGMSVKKLFEQLSDMRDEITLPVLLMGYINPVLQFGLENFCRRCAEVGVD
GLILPDMPVDEYLEFYKPIFDRYGILNIFLITPQTSDKRIRQIDDNSEGFIYMVSSASVT
GSQTGVSHDMEAYFERVNAMNLRNPRLIGFGIKDHETFSKACLHASGAIIGSAFIRVVQQ
NKHLEEAIRAYVSSVKQGS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtatcgtctccctctttgaacaacatcccacccggaatcttaacgtgtatttt
acggccggctaccctgcattggatgatacgcgacgtattttgaaagctcttcaggaggcg
ggagccgacctcgttgagataggaatgccttattctgaccccgtagcagacggcgaaacc
attcagatcagtaatcagcaggcgctggaaaacggtatgagtgtaaaaaagctgtttgaa
caactcagcgatatgcgggatgaaataaccttgcctgtattgttgatgggctacattaat
cctgtccttcaatttggtttggaaaacttctgtcgccgatgtgccgaagtgggcgtggat
gggttgattttacccgacatgccggtcgatgaataccttgaattttacaagccgattttt
gaccgttatgggatattgaatatattcctcattacgcctcaaacctccgataagcgcatc
cgccagatcgacgacaacagcgaaggatttatttatatggtctcctcagccagcgtgacc
ggctcacagacgggggtcagtcacgatatggaagcgtattttgagcgcgtcaatgcgatg
aatttacgcaatccgcgtttgatcgggtttggcatcaaagaccatgaaaccttttcaaaa
gcctgcctccatgcaagcggagccatcatcggcagtgcgtttattcgggtagtacagcaa
aacaaacacctcgaagaagcgatccgtgcgtatgtatcaagtgtaaagcaaggcagctga

DBGET integrated database retrieval system