KEGG   Runella slithyformis: Runsl_4655Help
Entry
Runsl_4655        CDS       T01553                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rsi  Runella slithyformis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Runsl_4655
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Runsl_4655
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Runsl_4655
Enzymes [BR:rsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Runsl_4655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5364946..5365725)
Genome map
AA seq 259 aa AA seqDB search
MNRIVSLFEQHPTRNLNVYFTAGYPALDDTRRILKALQEAGADLVEIGMPYSDPVADGET
IQISNQQALENGMSVKKLFEQLSDMRDEITLPVLLMGYINPVLQFGLENFCRRCAEVGVD
GLILPDMPVDEYLEFYKPIFDRYGILNIFLITPQTSDKRIRQIDDNSEGFIYMVSSASVT
GSQTGVSHDMEAYFERVNAMNLRNPRLIGFGIKDHETFSKACLHASGAIIGSAFIRVVQQ
NKHLEEAIRAYVSSVKQGS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtatcgtctccctctttgaacaacatcccacccggaatcttaacgtgtatttt
acggccggctaccctgcattggatgatacgcgacgtattttgaaagctcttcaggaggcg
ggagccgacctcgttgagataggaatgccttattctgaccccgtagcagacggcgaaacc
attcagatcagtaatcagcaggcgctggaaaacggtatgagtgtaaaaaagctgtttgaa
caactcagcgatatgcgggatgaaataaccttgcctgtattgttgatgggctacattaat
cctgtccttcaatttggtttggaaaacttctgtcgccgatgtgccgaagtgggcgtggat
gggttgattttacccgacatgccggtcgatgaataccttgaattttacaagccgattttt
gaccgttatgggatattgaatatattcctcattacgcctcaaacctccgataagcgcatc
cgccagatcgacgacaacagcgaaggatttatttatatggtctcctcagccagcgtgacc
ggctcacagacgggggtcagtcacgatatggaagcgtattttgagcgcgtcaatgcgatg
aatttacgcaatccgcgtttgatcgggtttggcatcaaagaccatgaaaccttttcaaaa
gcctgcctccatgcaagcggagccatcatcggcagtgcgtttattcgggtagtacagcaa
aacaaacacctcgaagaagcgatccgtgcgtatgtatcaagtgtaaagcaaggcagctga

DBGET integrated database retrieval system