KEGG   Runella slithyformis: Runsl_4755Help
Entry
Runsl_4755        CDS       T01553                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rsi  Runella slithyformis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Runsl_4755
Enzymes [BR:rsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Runsl_4755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5494380..5495321)
Genome map
AA seq 313 aa AA seqDB search
MQQRILVIGSSNTDMVVKANKLPAPGETVIGGVFLMNPGGKGANQAVAAARLGADVTFVA
KVGNDIFGKQAIQGFRQDKIRTEFVFADPKNPSGVALIGVDERGENSIMVAPGANGHLRP
HEVIQALEAVPEARLLLLQLEIPLETVIATIEQGANQGLNIILNPAPAQPLPDEIYAHLF
AITPNETETKLLTGMTVEAHDLDSLREAAAWFLAKGLKNVIITLGAKGAFLYNSDGGQLI
AAPPVTATDTTAAGDVFNGALVVALSENKSLTEAVTFACKAASISVTRMGAQASVPTRKE
VDSLSLMTPITPH
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaacgaatactggtcatcggttcttccaacaccgacatggtcgtcaaagccaac
aaactgccggcccccggcgaaactgtcattgggggggtatttttgatgaatcccggcggg
aaaggagccaatcaggccgtcgcggcggcgcgtttgggcgcggatgtcacctttgtggcg
aaagtaggcaacgatatttttgggaaacaggccattcagggctttcggcaggataagatt
cggactgaatttgtgtttgcggaccctaaaaatccttcgggcgtggccctgatcggggtg
gatgagcgcggcgaaaacagcatcatggtcgcgcccggggccaatggccatttgcgtccg
cacgaagtgatacaggcattggaagctgttccggaagcccgattgctcctgctgcaattg
gagattccgctcgaaactgtcattgcgaccattgaacagggggcaaatcaaggactgaac
attattttaaatccggcccccgcacagcccctgcccgacgagatttatgcccatctgttt
gccattacgcccaacgaaaccgagactaaactcctcacgggcatgaccgtggaggcccac
gaccttgattcgctccgggaggcggccgcatggtttttggcaaaaggtctcaaaaatgtg
atcatcaccctcggcgctaaaggcgcgtttttgtacaattccgacggcggtcaactcatt
gcggcaccgcccgttaccgccaccgataccacggcggccggtgatgtgttcaacggtgcc
ttggtcgtggctctgtcagaaaacaaatctttgacggaagccgtgacgtttgcctgcaag
gccgcctccatttcggtcacccggatgggcgcacaggcatccgtacctacgcgcaaagaa
gtagactctttatccttaatgactcctataactcctcactaa

DBGET integrated database retrieval system