KEGG   Runella slithyformis: Runsl_4923Help
Entry
Runsl_4923        CDS       T01553                                 

Definition
hypothetical protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
rsi  Runella slithyformis
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Runsl_4923
Enzymes [BR:rsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Runsl_4923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5689087..5691285
Genome map
AA seq 732 aa AA seqDB search
MKFTAFSFFFFLFFSFLTPIHAQNDPYLHRRYDALHDSPMQQKFRKLAPMPAGVVYVQQP
NEGEKEMREHFRNMKKLGFNALKQIMPLPTWTIEQISSVALEEGIIPWWYGEGGYEEITP
ALLEQLGIAKSLSMNDIIQHPKMVNYQKEVAKKRIQNIEKYIQNSPDKKFMRVTSVAYDP
EIGGRGVELSDKGEALFLDWLKKRYRTVENLNQAWNQYHAGLFLNEQRVLSDWDDVAKNW
RNLTGREYNHVKDIYRFKVEHNLGRIRESAAQFNRFDPNAPYRGGGELAVFHPFAWYGVD
MEGIADVLTQYGSFYPSMHFSWHYNLVKGEITKSLYQQASLMNDFNKGGWTGGWESTGGP
MQMDGEKNPGHNNSYYVGPDELMQLYLSQLAAGFKGFGIWCWNARSAGKEGGEYSLLDRN
GQITDRAVAIGQLGKAMQKYRFELWNAHKEPLVGILYDWENEATWGAMSIPGREDFRFQP
VKARIGISNLLMTNNVPFEYLTPNDLFKGLAGRYKVLYLPAMLTMRKELLPLLKKYVQEG
GRLVMDLPSGWYDENTVNLPTGKGSEFEQLFGATIDDFQFSGTNRQLRISGKEVQGFTIN
STATKARVAERYDNGKPAILEHSIGKGKAILLGFQAALNAFETSAKASFPLLQYTLGAYS
SSYSCLNALVYRLAAPEADHYFVLNESTAQTVALTFKNHSYKRITDAVTGAPVNISQITL
TTKGGRWLRAEK
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcaccgcattttccttttttttcttcctgtttttcagctttctaaccccaatc
cacgcccaaaacgacccgtacctgcaccggcggtacgacgccctgcacgactcacccatg
cagcagaagtttcgcaagttggctcctatgccggcgggggtcgtctatgtacaacaaccc
aacgaaggcgaaaaagaaatgcgggagcacttcagaaacatgaaaaaactgggattcaac
gcattaaagcagatcatgcccttgccgacctggaccattgagcagatttcgtcggtggcg
ctggaagaaggcattattccgtggtggtacggcgaaggcggttacgaagagattaccccg
gcgcttttggaacaacttggcatagccaaaagcctatcaatgaacgacataattcagcac
cccaagatggtgaattatcaaaaagaggttgccaaaaaacgaattcagaacattgaaaaa
tacatccaaaacagccccgacaaaaaattcatgcgagtcacgagcgtggcctacgacccc
gaaatcggtgggcgcggcgtagagctcagtgacaaaggcgaagcattgtttttggattgg
ctcaaaaagcgctaccgcacggtagaaaacctgaatcaagcctggaatcagtaccacgcg
gggcttttcctgaacgaacagcgggtgttgagtgattgggacgatgtagcaaaaaattgg
cgcaatctcacgggcagagaatacaatcatgtcaaagacatttatcggtttaaggttgag
cacaatctcggccgaatccgcgaatctgccgcccaattcaatcgcttcgaccccaacgca
ccgtaccgaggcggcggcgaattggccgtttttcacccctttgcgtggtacggagtggac
atggaaggcatcgccgacgtgttgacgcaatacggctccttttacccctccatgcatttt
tcgtggcattataatttggtcaaaggtgaaatcaccaagtcactctatcagcaggcttcg
ctgatgaatgacttcaataaaggcggctggacgggcggctgggaaagcaccggcggcccc
atgcagatggatggtgaaaaaaatccgggtcacaacaactcctactacgttggcccggat
gaattaatgcagctctacctcagtcagttggcggcgggcttcaaaggttttgggatttgg
tgctggaatgcccgaagtgcgggaaaagaaggcggtgagtatagcctgctggatcgaaac
ggacaaatcaccgaccgcgccgtggccatcgggcaattgggaaaagccatgcaaaaatac
cgttttgaactctggaatgcccacaaagagccgctcgtgggtatcctgtacgactgggaa
aatgaggccacttggggagctatgagcattccgggacgcgaagattttagatttcagccc
gttaaagcccgaattggaatcagcaatcttctcatgaccaacaacgtcccttttgaatac
cttacccccaacgatctttttaaaggcttagccgggcgctacaaagtgctgtatctgccg
gccatgctcacgatgcgaaaagaactgttgcccctgttgaaaaaatacgtgcaggaaggc
ggacgtttggtcatggacttaccttccggctggtacgacgaaaataccgtcaacctcccg
accggcaaaggctcggagtttgagcagctttttggggctacgattgatgattttcaattt
tcgggcaccaatcggcaactgcgtatttcggggaaagaagtacagggttttaccatcaat
tcaacggctaccaaggcccgtgtggcagaaagatacgacaatggtaaacccgccatttta
gaacattctatcggcaaagggaaagccatcttactcggctttcaggcagcccttaacgca
tttgaaacctctgcaaaggcttcatttccccttttgcagtacacactcggtgcttattca
tcttcctattcctgccttaacgccctcgtatatcgtttggcggcacccgaagccgaccat
tattttgtgttgaatgagtcgaccgcccaaacggttgcgctgacctttaagaatcacagc
tataaacgtatcaccgatgccgtcaccggtgcgccggtcaacatcagccaaatcacattg
acgaccaagggcgggcgttggctacgggcggaaaaataa

DBGET integrated database retrieval system