KEGG   Runella slithyformis: Runsl_5260Help
Entry
Runsl_5260        CDS       T01553                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rsi  Runella slithyformis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Runsl_5260
Enzymes [BR:rsi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Runsl_5260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6115077..6115772
Genome map
AA seq 231 aa AA seqDB search
MKPNETLWNTPREAADFVDLTIDEWGDDHSLSAYETPMREDAFELSDVEKVTKIEQHFKA
IMETLGLDLTDDSLKGTPHRVAKMYVKEIFSGLNPKNKPKATLFENKYNYNEMLVEKDIS
FYSNCEHHFVPIFGKAHVAYISSGKVIGLSKLNRIVQYFAKRPQVQERLTIQIGKELQQI
LQTEDVAIVMDAKHLCVASRGVQDDTSTTITSFYGGKFKEEATKNEFLKYL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgaacgaaactttgtggaataccccgcgtgaggctgccgatttcgttgatttg
accattgacgaatggggcgacgaccatagcctgagtgcgtatgaaactcccatgcgcgaa
gatgccttcgagctgagcgatgtagagaaagtaaccaaaattgagcagcattttaaagcg
atcatggagacattgggtctcgacctgaccgacgacagcctgaaagggaccccccaccgg
gtggctaaaatgtacgtgaaagagattttcagcggcctgaatcctaagaataaacccaaa
gccactttatttgaaaataaatacaactacaacgaaatgttggtggagaaagacatcagt
ttttactccaactgtgaacatcactttgtgcctattttcggtaaagcacacgtggcttat
atctcaagcggcaaggtaatcggcctttcgaagctgaaccgcattgtgcagtattttgcc
aaacgccctcaggttcaggagcgtttgacgatacagatcggcaaagaattacaacagatc
ctccaaacggaagatgtggccatagtaatggatgccaagcacctgtgcgtagcctcgcgc
ggtgtacaggatgatacaagcaccacgatcacgtctttttacggcggtaagttcaaagaa
gaagcgaccaaaaatgagtttctgaagtatctgtaa

DBGET integrated database retrieval system