KEGG   Runella slithyformis: Runsl_5517Help
Entry
Runsl_5517        CDS       T01553                                 

Definition
3-hydroxybutyryl-CoA epimerase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rsi  Runella slithyformis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Runsl_5517
   01212 Fatty acid metabolism
    Runsl_5517
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Runsl_5517
   00650 Butanoate metabolism
    Runsl_5517
  Lipid metabolism
   00071 Fatty acid degradation
    Runsl_5517
   01040 Biosynthesis of unsaturated fatty acids
    Runsl_5517
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Runsl_5517
   00310 Lysine degradation
    Runsl_5517
   00380 Tryptophan metabolism
    Runsl_5517
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Runsl_5517
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Runsl_5517
   00281 Geraniol degradation
    Runsl_5517
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Runsl_5517
Enzymes [BR:rsi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Runsl_5517
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Runsl_5517
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Runsl_5517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6396931..6399099)
Genome map
AA seq 722 aa AA seqDB search
MTINCTTNNNIAILSWNMTGSPMNVLNDDSVPAFAEALEKAYSDAEVKGIIITSDKPEFV
AGADLKMILRNQGENPAEILKISVELNRLFRKIETNGKPVVAAINGTALGGGLEICLACH
YRVALDNPKTKLGLPEVKVGLLPGGGGTQRLPRMIGMQAALPLMLEGKEMTPKEALGLGI
VDAVAATREEMLEKAASWIAANPNPVKPWDEVNKKTGKIQAKDNYKVPNGAVLSPVGMQT
FTVGTAMMMDKSKGNYPAAQHIMSCVYEGLLVNIDRGIVIESRHFVQVATSKVAGNLIRT
MFLGLNEANKGASRPKDIPKTDVKKLGVLGAGMMGAGIAYVSAVAGIEVVLKDVSAEAAE
KGKDYARTLLKKAVERGKMDTLTAEGILDRIKPTADTADLQGSELIIEAVFENRDLKATV
TQEAEPMLAAGGVFGSNTSTLPITGLADASANPANFVGIHFFSPVDKMMLVELIVGKETS
DYALAVAVDFTRKIRKTPIVVNDSRGFYTSRCFGTYTSEGMELLKDGVSPVLIENAGKLA
GMPVGPLAVTDEVALDLVYKISAQAVKDGVLADTDTSYQIGKRFTEMGRLGKKAKAGFYD
YPEGGQKQLWAGLTELFPVVTVQPSLEEVKTRLLYRQALETVRCYEEGVIRTKLDADLGS
ILAWGFPPYTGGTLSFVDFVGINTFVTTLDRLADTYGERFRPTQKLREMAAEGVGFSAKK
QS
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgactatcaactgcacaaccaataataacatagccatcctgagctggaacatgaccggc
tcacccatgaatgtacttaacgacgactccgtccctgcctttgcggaagcgctggaaaaa
gcgtacagcgatgcggaggtcaagggtattattatcacctccgataagcccgaatttgtg
gccggagcggatctgaagatgatcttacggaatcagggcgaaaatccggccgaaatattg
aagatatcggtggagctcaatcggctttttcgaaagatcgaaaccaatggtaaacccgtc
gtggcggccatcaacgggacggctttgggcggagggttggagatatgtttggcgtgccat
tatcgggtggcgctcgacaatcccaagacgaaactcggtctccccgaagtaaaagtgggc
ctgctgcccggtggcggcggtacgcagcgattgccccgaatgatcggaatgcaggcggct
ttgccgttgatgctggagggcaaagaaatgacccccaaagaagcattggggctgggtatc
gtggatgccgtggctgcaacgcgggaagagatgctggaaaaggccgcttcctggattgcc
gccaatcccaaccctgttaagccatgggatgaggtcaataagaaaacgggtaaaattcag
gccaaagacaattataaagtacccaatggcgcggtattgagcccggtcggaatgcagacc
tttacggtaggtacggccatgatgatggataagtccaaagggaattatcccgctgcgcaa
cacatcatgtcgtgtgtatatgaaggactgttggtcaatatcgaccgaggcattgtgatc
gaatcgcggcattttgtgcaggtagccacctccaaagtagcaggaaatctgattcggacc
atgtttctgggcctgaacgaagccaataaaggagcaagtcggcccaaagatattccgaaa
accgacgtaaagaagctgggtgttctgggggccggaatgatgggcgcaggcattgcgtac
gtgagtgccgtggcgggcattgaggtagtactgaaagatgtcagtgcggaagccgccgaa
aagggaaaagattacgcgcggacattgctgaaaaaagccgtcgaacgcgggaaaatggat
actctcaccgccgaaggtattttggatcgtatcaagccaacggccgataccgctgattta
cagggaagtgaactgatcattgaagcggtttttgaaaaccgtgatctcaaggctaccgtt
acccaagaagccgagccgatgctcgccgcaggcggggtgtttggctccaatacatccacc
ctgcccattaccggcttagccgacgcttcggcaaatcccgccaattttgtgggaatccac
ttcttttcacccgttgataaaatgatgttggtagagctgatcgtgggcaaagaaacgtcc
gattatgctttggctgtcgcggtagactttacccgtaagatccgaaaaacaccgatcgtg
gtcaatgactcgcggggattttatacatcccgctgttttgggacctatacttccgaagga
atggaattgctcaaagacggcgtgagtccggtattgatcgaaaacgccggaaaattggca
ggaatgcccgtcggaccgttggcagttaccgacgaagtggcgctggatctggtgtataag
atttcggcgcaggcagtaaaagacggtgtgttggccgataccgacacgagctatcaaatc
ggtaagcggtttacggaaatgggccgtttgggcaagaaagccaaagccggattttatgac
taccctgaaggcggtcaaaagcaattgtgggccggattaacggaattatttcccgtggta
acggtacagccttcgttggaagaagtgaaaacgcgtttgctgtaccgccaggcacttgaa
accgttcgctgctacgaagaaggggttatccgtactaagttggatgcggatctgggctct
atattggcgtggggctttccaccgtatacgggcggcacactctcttttgtggattttgtg
ggcatcaatacctttgtaactaccctcgaccgtttggcggatacctacggcgagcgtttt
cgccccacgcagaaactgcgcgaaatggcggcggaaggtgttgggttttcagcaaagaag
cagtcttag

DBGET integrated database retrieval system