KEGG   Rhodobacter sphaeroides KD131: RSKD131_0082Help
Entry
RSKD131_0082      CDS       T00844                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00900  Terpenoid backbone biosynthesis
rsk01100  Metabolic pathways
rsk01110  Biosynthesis of secondary metabolites
rsk01130  Biosynthesis of antibiotics
Module
rsk_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RSKD131_0082
Enzymes [BR:rsk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RSKD131_0082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACL99941
UniProt: B9KLF9
Position
1:74410..75246
Genome map
AA seq 278 aa AA seqDB search
MTEAFARAKINLTLHVTGQRPDGYHLLDSLVVFADVGDRVRAEPAEALSLAITGPQAANL
PVADDNLVLRAARTLGGQGARLTLEKHLPVASGIGGGSADAAAALVALARLWQVPLPDPA
AVLKLGADVPVCLEGRAVRMAGVGEILTPLAAPLPEAWLVLANPGVSVPTPPVFKALARR
DNPPMPDDLPGWPTVESLAALLATQRNDLEPPAIALAPEIARTRAALAAQPGCLLARMSG
SGATCFGLFAAEEAARAAAEAIGTQHPGWWVAPARMVG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagcctttgcccgcgcgaagatcaacctgaccctgcatgtcaccggccagcgg
ccggacggctatcaccttctcgactcgctcgtggtctttgccgatgtgggcgaccgggtg
cgggccgaaccggccgaagcgctgagccttgccatcaccgggccgcaggcggcgaacctg
ccggtggcggacgacaatctggtgctgcgcgccgcccggacgctgggcgggcagggggcg
cggctcacgctcgagaagcatctgccggtggcctcgggcatcggcggcggctccgccgat
gcggcggcggccctcgtggcgctggcccggctctggcaggtgccgctgccggatcccgcc
gctgttctgaagctcggcgccgacgtgccggtctgcctcgaaggccgcgcggtgcgcatg
gccggggtgggcgagatcctgacgccgctcgcagcgcccttgcccgaagcctggctggtg
ctggcgaaccccggcgtgtcggtgccgacgcccccggtcttcaaggcgctcgcccggcgg
gacaacccgccgatgcccgacgatctgcccggctggcccaccgtcgagtccctggctgcg
ttgctggccacgcagcgcaacgatctggagccgcccgccatcgcgcttgcgcccgagatc
gcccggacccgcgccgcccttgccgcgcaaccggggtgcctgctggcccgcatgtcggga
tcgggcgcgacctgcttcggcctctttgccgccgaagaggccgcgcgggctgcggccgag
gccatcgggacacagcaccccggctggtgggtggcgcctgcccgtatggtgggctga

DBGET integrated database retrieval system