KEGG   Rhodobacter sphaeroides KD131: RSKD131_0091Help
Entry
RSKD131_0091      CDS       T00844                                 

Definition
PTS system fructose subfamily transporter subunit IIC
Orthology
K02769  
PTS system, fructose-specific IIB component [EC:2.7.1.69]
K02770  
PTS system, fructose-specific IIC component
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Fructose and mannose metabolism
Metabolic pathways
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rsk00051]
Environmental Information Processing; Membrane transport; Phosphotransferase system (PTS) [PATH:rsk02060]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:84474..86219
Genome map
AA seq 581 aa AA seqDB search
MTGIVAVISTGSFGPHAALAREALRKAAQGLGRAIAVELRTQETVTDALPPEAVSGASQV
LLVTEPGGAAADEARFAGRPTIHATLAEVLEDAPGVLARTGSGAAAAPASAPAAAEGALK
IVAITSCPTGIAHTFMAAEGLVEGARAQGHQIRVETQGSVGAQDELTAAEIAAADLVIIA
ADKQVDLGRFGGKRLFLSPTKPAITDGAGLIRKAQAEARMQAGSASSEAAQPEAKKVGVY
KHLMTGVSFMLPFVVAGGLLIAIAFALGGIYVYEDQYAGTLGHTLFQIGAKGAFTLMVPA
LAGYIAWSIADRPGLAPGMTGGVIAGTIGAGFLGGIVAGFIAGYGVLWLNRAIKLPKTLQ
GLKPVLILPLLGTALTGLLMYYVVGEPTARLLATITAFLQGMQGTSAALLGLLLGGMMAV
DMGGPVNKAAYAFATTLIAANVLEPMAAVMCAGMVPPIALAVACRLLPARFTPEEREAGN
AAFVLGLAFVTEGAIPFAARDPLRVIPSLIAGSAVAGAICMALGVAQRVPHGGIFVLPIP
NAVTNLTGFGIALVAGTAVSVLALALVKRRIVVPAAVPSAV
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcatcgtcgccgtcatttcgacggggagcttcgggcctcatgcggccctcgca
cgcgaggcgctgcgcaaggccgcgcaggggctgggccgcgccatcgcggtcgagctgcgc
acacaggagaccgtgaccgacgcgctgccgcccgaggcggtgagcggcgcaagccaggtg
ctgctcgtgaccgagcccggcggggctgcggccgacgaggcccgcttcgccggcaggccc
acgatccacgcgacgctggcggaggtgctggaagatgcgccgggcgtgctggcccgcacc
ggatccggcgccgccgcggctccggcctctgctccggccgcggccgagggcgcgctgaag
atcgtggccatcacctcctgccccaccggcatcgcccatacgttcatggcggccgagggc
ctcgtcgagggcgcccgcgcgcagggccatcagatccgggtcgagacccagggctctgtc
ggcgcgcaggacgaactgaccgcggccgagattgcggcggccgatctcgtcatcatcgcg
gccgacaagcaggtggatctcgggcgcttcggcggcaagcgcctgttcctctcgcccacc
aagcccgcgatcaccgacggcgcgggcctgatccgcaaggcgcaggccgaggcgcggatg
caggccggctcggcctcctccgaggctgcgcagcccgaggccaagaaggtcggcgtctac
aagcacctgatgacgggcgtctccttcatgctgcccttcgtggtggcgggcgggcttctc
atcgccatcgccttcgctctgggcgggatctacgtctatgaggaccagtatgccggcacg
ctcggccatacgctgttccagatcggcgcgaagggggccttcacgctgatggtgccggcg
ctggcgggctatatcgcctggtccatcgccgaccggcccggcctcgcccccggcatgacc
ggcggagtcatcgcgggcaccatcggcgcgggcttcctcggcgggatcgtcgcgggcttc
atcgcgggctacggcgtcctgtggctcaaccgcgcgatcaagctgccgaagaccctgcag
gggctgaagcccgtgctgatcctgccgctcctcggcacggcgctgaccgggcttctgatg
tattatgtcgtgggcgagcccacggcgcggctgctggccaccatcaccgccttcctgcag
gggatgcagggcacgtcggccgcccttctggggctgctcctcggcggcatgatggcggtg
gacatgggcgggcccgtcaataaggcggcctatgccttcgccaccacgctcatcgcggcc
aatgtgctggagccgatggcggccgtcatgtgcgcgggcatggtgccgcccatcgcgctc
gcggtggcctgccggctcctgcccgcccgcttcacccccgaagagcgcgaggccggcaat
gcggccttcgtgctgggcctcgccttcgtgaccgagggcgcgatccccttcgcggcgcgc
gatccgctgcgggtgatcccgagcctcatcgcgggctcggcggtggcgggggcgatctgc
atggcgctcggcgtggcgcagcgcgtgccgcacggcgggatcttcgtcctgccgatcccc
aatgccgtgacgaacctcacgggcttcgggatcgccctcgtggcgggcacggcggtctcg
gttctcgcgctggcgctggtgaagcggcggatagtggtgcccgcggcggtgccctcggcc
gtctga

DBGET integrated database retrieval system