KEGG   Rhodobacter sphaeroides KD131: RSKD131_0130Help
Entry
RSKD131_0130      CDS       T00844                                 

Definition
alcohol dehydrogenase, zinc-binding domain-containing protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RSKD131_0130
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSKD131_0130
  Lipid metabolism
   00071 Fatty acid degradation
    RSKD131_0130
  Amino acid metabolism
   00350 Tyrosine metabolism
    RSKD131_0130
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RSKD131_0130
   00626 Naphthalene degradation
    RSKD131_0130
Enzymes [BR:rsk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RSKD131_0130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:126410..127534
Genome map
AA seq 374 aa AA seqDB search
MKITAAVLERDGIAGNYAEERPLAIRELDLAAPGPGEVLIRVAAAGICHSDLSVINGTRR
RPLPMVLGHEASGHVEALGEGVEDLEPGDHVVCIFAPGCGRCTPCAEGRPALCEKAARHH
AVGELMTGHRRLSLGGRPVHHHLGISGFATHAVVARPSLVRVPREVPPHVSALFSCAMLT
GAGAVFNTAQIRPGSKVAVVGLGGVGLSAILGAAAAGAAEIVAIDPFPAKMEAARAMGAT
LSVPADGDTVAAVRDLTAGGVDYAFELAGSVRALETAFAVTRRGGMTVTAGLPHPDDRMS
LEALKLVAEERTLKGSYIGSCVPQRDLPRMLALHRRGLLPVEKMLTHRLKLDEINLAMDR
LAEGSAIRQVVDLG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcacggcggcggtgctcgaacgcgacgggatcgcggggaattatgccgaggag
cggccgctcgcgatccgcgagctcgatctcgcggcgccggggccgggcgaggtcctgatc
cgggtggccgccgcgggcatctgccattcggacctgtcggtcatcaacggcacgcggcgg
cggccgctgccgatggtgctcggccacgaggcctcgggccatgtcgaggctctgggcgag
ggggtcgaggatctcgagcccggcgaccatgtcgtctgcatcttcgcacccggctgcggc
cgctgcacgccctgcgccgaggggcggcctgcgctctgcgagaaggcggcgcgccatcat
gcggtgggcgaactgatgaccgggcaccggcggctctcgctcggcgggcggcccgtgcac
catcacctcggcatctcgggctttgccacccatgccgtggtggcgcggccctcgctggtt
cgcgtcccgcgcgaggtcccgccccatgtctcggcgcttttctcctgcgccatgctgacg
ggggcgggggccgtcttcaacacggcgcagatccggcccggctcgaaggtcgccgtggtg
gggctgggcggcgtcggactgtccgccatcctcggcgcggcggcggcgggcgcggccgaa
atcgtggcgatcgacccgtttcccgccaagatggaggccgcgcgcgccatgggcgcgacg
ctctcggtgcccgcggacggagatacggtcgcggcggtgcgcgacctgacggcgggcggc
gtcgattacgccttcgagctggcgggctcggtccgggcgctggaaaccgccttcgccgtc
acccgccgcggcggcatgacggtgaccgcgggcctgccccacccggacgaccggatgtcg
ctcgaagcgctgaagctcgtggccgaggagcgcaccctgaagggcagctacatcggatcc
tgcgtgccccagcgcgacctgccgcggatgctggcgcttcaccgccgcggcctgctgccg
gtcgagaagatgctgacccaccggctgaagctcgacgagatcaacctcgcgatggaccgg
ctggccgagggcagcgcgatccggcaggtggtggatctcggctga

DBGET integrated database retrieval system