KEGG   Rhodobacter sphaeroides KD131: RSKD131_0138Help
Entry
RSKD131_0138      CDS       T00844                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSKD131_0138
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSKD131_0138
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RSKD131_0138
Enzymes [BR:rsk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RSKD131_0138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:133512..134912
Genome map
AA seq 466 aa AA seqDB search
MKAVKMQYISTRGAAPVLGFGEAMLTGLARDGGLYVPETVPTLSESEIAALAGLSYEEVA
FRIMRPFVGETFGDEEFRGLIAAAYEGFGHAARAPLVQLGPNHFLLELFHGPTLAFKDFA
MQLIGQLFQAALAKNGQRITIVGATSGDTGSAAIEAFRGLSNVDVFILFPHGRVSEVQRR
QMTTPSEANVHALAVDGDFDDCQARLKDMFNDFAFRDAVGLAGVNSINWARVLAQVVYYF
TSAVALGAPHREVSFTVPTGNFGDIFAGYIARRMGLPIARLVVATNQNDILHRALSTGAY
ETEGVTPSISPSMDIQVSSNFERALFDAYGRDGAAVAALMAELKEGGFRISENALGTLRA
TFASGRASEEETLATIRATHAATGELLCPHSAVGVKVAEEALGPEPMITLATAHPAKFPD
AVEAATGLRPPLPARMADLFDRPERVTRVPNDLSALETLIRERTGR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggtaaagatgcagtatatctcgactcgcggtgcggctccggttctcggcttc
ggcgaggccatgctgacgggccttgcccgggacggcggtctctatgtgcccgagaccgtg
cccaccctgtcggagtccgagatcgcggcgctcgcgggcctgtcctacgaggaggtggcc
ttccgcatcatgcggcccttcgtgggcgagaccttcggggacgaggagttccgcggcctg
atcgccgccgcctacgagggcttcggccatgccgcccgcgcgccgctggtgcagctcggc
ccgaaccacttcctgctcgagctgttccatgggcccacgctcgccttcaaggacttcgcc
atgcagctgatcggccagctgttccaggcggcgctggcgaagaacgggcaacggatcacc
atcgtcggcgccacctcgggcgacaccggctcggccgcgatcgaggccttccgcggcctc
tcgaacgtcgatgtcttcatcctcttcccgcacggccgcgtgtccgaggtgcagcgccgc
cagatgacgacgccgtccgaggcgaacgtgcatgccctcgcggtggacggcgacttcgac
gattgccaggcccggctgaaggacatgttcaacgacttcgccttccgcgatgcggtgggg
ctggcgggcgtcaattcgatcaactgggcgcgggtgctggcgcaggtcgtctattacttc
acctcggccgtggcgctcggcgcgccgcaccgcgaggtgagcttcacggtgcccaccggc
aatttcggcgacatcttcgcgggctacatcgcgcgccggatgggtctgcccatcgcgcgc
ctcgtggtggccacgaaccagaacgacatcctgcaccgtgcgctttcgaccggagcctac
gagaccgagggcgtcaccccctcgatcagcccctcgatggacattcaggtctcctcgaac
ttcgagcgcgcgctcttcgatgcctatggccgcgacggggcggcggtggcggccctcatg
gccgagctgaaggagggcggcttccgcatctccgagaatgcgctggggacgctgcgcgcg
acctttgcctcgggccgcgcttccgaggaagagacgctggccacgatccgcgccacccat
gcggcgacgggcgagcttctctgcccccattcggccgtgggcgtgaaggtggccgaagag
gcgctcggccccgagccgatgatcacgctcgccaccgcccatccggcgaagttccccgat
gccgtcgaggccgcgaccggcctgcgcccgccgctgcccgcccgcatggcggatctcttc
gaccgccccgagcgggtgacgcgcgttcccaacgacctctccgccctcgaaaccctcatc
cgcgaaaggaccgggcgttga

DBGET integrated database retrieval system