KEGG   Rhodobacter sphaeroides KD131: RSKD131_0138Help
Entry
RSKD131_0138      CDS       T00844                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rsk01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:rsk00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:rsk00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:133512..134912
Genome map
AA seq 466 aa AA seqDB search
MKAVKMQYISTRGAAPVLGFGEAMLTGLARDGGLYVPETVPTLSESEIAALAGLSYEEVA
FRIMRPFVGETFGDEEFRGLIAAAYEGFGHAARAPLVQLGPNHFLLELFHGPTLAFKDFA
MQLIGQLFQAALAKNGQRITIVGATSGDTGSAAIEAFRGLSNVDVFILFPHGRVSEVQRR
QMTTPSEANVHALAVDGDFDDCQARLKDMFNDFAFRDAVGLAGVNSINWARVLAQVVYYF
TSAVALGAPHREVSFTVPTGNFGDIFAGYIARRMGLPIARLVVATNQNDILHRALSTGAY
ETEGVTPSISPSMDIQVSSNFERALFDAYGRDGAAVAALMAELKEGGFRISENALGTLRA
TFASGRASEEETLATIRATHAATGELLCPHSAVGVKVAEEALGPEPMITLATAHPAKFPD
AVEAATGLRPPLPARMADLFDRPERVTRVPNDLSALETLIRERTGR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggtaaagatgcagtatatctcgactcgcggtgcggctccggttctcggcttc
ggcgaggccatgctgacgggccttgcccgggacggcggtctctatgtgcccgagaccgtg
cccaccctgtcggagtccgagatcgcggcgctcgcgggcctgtcctacgaggaggtggcc
ttccgcatcatgcggcccttcgtgggcgagaccttcggggacgaggagttccgcggcctg
atcgccgccgcctacgagggcttcggccatgccgcccgcgcgccgctggtgcagctcggc
ccgaaccacttcctgctcgagctgttccatgggcccacgctcgccttcaaggacttcgcc
atgcagctgatcggccagctgttccaggcggcgctggcgaagaacgggcaacggatcacc
atcgtcggcgccacctcgggcgacaccggctcggccgcgatcgaggccttccgcggcctc
tcgaacgtcgatgtcttcatcctcttcccgcacggccgcgtgtccgaggtgcagcgccgc
cagatgacgacgccgtccgaggcgaacgtgcatgccctcgcggtggacggcgacttcgac
gattgccaggcccggctgaaggacatgttcaacgacttcgccttccgcgatgcggtgggg
ctggcgggcgtcaattcgatcaactgggcgcgggtgctggcgcaggtcgtctattacttc
acctcggccgtggcgctcggcgcgccgcaccgcgaggtgagcttcacggtgcccaccggc
aatttcggcgacatcttcgcgggctacatcgcgcgccggatgggtctgcccatcgcgcgc
ctcgtggtggccacgaaccagaacgacatcctgcaccgtgcgctttcgaccggagcctac
gagaccgagggcgtcaccccctcgatcagcccctcgatggacattcaggtctcctcgaac
ttcgagcgcgcgctcttcgatgcctatggccgcgacggggcggcggtggcggccctcatg
gccgagctgaaggagggcggcttccgcatctccgagaatgcgctggggacgctgcgcgcg
acctttgcctcgggccgcgcttccgaggaagagacgctggccacgatccgcgccacccat
gcggcgacgggcgagcttctctgcccccattcggccgtgggcgtgaaggtggccgaagag
gcgctcggccccgagccgatgatcacgctcgccaccgcccatccggcgaagttccccgat
gccgtcgaggccgcgaccggcctgcgcccgccgctgcccgcccgcatggcggatctcttc
gaccgccccgagcgggtgacgcgcgttcccaacgacctctccgccctcgaaaccctcatc
cgcgaaaggaccgggcgttga

DBGET integrated database retrieval system