KEGG   Rhodobacter sphaeroides KD131: RSKD131_0172Help
Entry
RSKD131_0172      CDS       T00844                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RSKD131_0172
Enzymes [BR:rsk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     RSKD131_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:172269..173306
Genome map
AA seq 345 aa AA seqDB search
MTYVRPIPLADAARPKGALPLAGGPLFFDRVEILERGRPPVVLPAAELDAATLAPLTAPR
PPVAGLAMDRPQIMGILNATPDSFSDGGRFATLPEALEQAQALVAAGADILDIGGESTRP
GAAEVEPAEEIRRTAPVIEMLRGQGIAVPVSIDTRKAPVAEAALIAGADLVNDVAALTWD
AGLAAVAARREAPVCLMHAQGTPQTMQADPRYDDVLLDVYDWLAERIRAAEAAGIPRARI
VTDPGIGFGKTLEHNLALLRRLSLFHGLGCPILLGASRKRFIGALADEPSADRRMAGSVA
VALAGAAQGAQILRVHDVRETRQALILWQAVTREAAETAAERRQA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgacctatgtccgtccgatcccgctcgccgatgcggcccgccccaagggcgcgctgccg
ctcgccggcggcccgctgttcttcgaccgcgtcgagatcctcgaacgcgggcgtccgcct
gtcgtgctgcccgcagccgagctcgatgcggcgaccctcgcccccctgacggcgccgcgg
cctccggtggcggggctcgcgatggatcggccgcagatcatgggcatcctcaacgcgacg
cccgacagtttctcggacggcggccggttcgccacgctgcccgaggcgctggagcaggct
caggcgctggtggcggcaggcgcggacatcctcgacatcggcggcgagagcacgcggccc
ggtgctgcggaggtggagccggccgaggagatccgccgcaccgcgccggtgatcgagatg
ctgcgcgggcaggggatcgccgtgccggtctcgatcgacacccgcaaggccccggtggcc
gaggccgcgctgatcgcgggggccgatctcgtgaacgatgtggcggccctgacctgggac
gcgggactggccgccgtggcggcgcggcgggaggcgccggtctgcctcatgcatgcgcag
ggcacgccgcagaccatgcaggccgatccgcgctacgacgatgtgctgctcgatgtctac
gactggctggccgagcgcatccgggcggccgaggcggcgggcatcccgcgggcgcggatc
gtgaccgacccgggcatcggcttcggcaagacgctcgagcacaatctggcgctgctgcgc
cggctgtcgctctttcacgggctgggctgtccgatcctgctcggcgcttcgcgaaaacgt
ttcatcggcgcgctggcggacgagccttcggccgaccggcgcatggcgggctcggtcgcc
gtcgcgcttgcgggcgcggcgcaaggagcgcagattctcagagtgcacgacgtgcgcgag
acacgtcaggcgctgatcctgtggcaggcagtcacacgcgaggcggcagagaccgcggca
gaacggaggcaggcatga

DBGET integrated database retrieval system