KEGG   Rhodobacter sphaeroides KD131: RSKD131_0259Help
Entry
RSKD131_0259      CDS       T00844                                 

Definition
Triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSKD131_0259
   01230 Biosynthesis of amino acids
    RSKD131_0259
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSKD131_0259
   00051 Fructose and mannose metabolism
    RSKD131_0259
   00562 Inositol phosphate metabolism
    RSKD131_0259
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RSKD131_0259
Enzymes [BR:rsk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RSKD131_0259
Exosome [BR:rsk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RSKD131_0259
  Exosomal proteins of bladder cancer cells
   RSKD131_0259
  Exosomal proteins of melanoma cells
   RSKD131_0259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(256849..257598)
Genome map
AA seq 249 aa AA seqDB search
MGKKMRKLAAGNWKMNGTEADLGEIDALLAAHPSPRCEMLICPPATLLARMAGRAAQGLM
VGGQDCHPKTSGAHTGDVSAAMLADAGASHVILGHSERRADHGETDSLVRLKAEAAWGAG
LVAIVCVGETEAQRDAGQTLDVIGAQLAGSVPEAATAANTVIAYEPVWAIGTGRTPTTAE
IAEVHAFLRARLAERFSDAEGFRLLYGGSVKPSNAAEIFAVPNVDGALVGGASLKAADFG
GIVAALSAA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaagatgcgcaaacttgcggccggaaactggaagatgaacggaaccgaggcg
gatctgggcgagatcgacgccctgctcgccgcccatccgtcgccccgctgcgagatgctg
atctgtccgcccgcgacgcttcttgcccgcatggcgggacgcgcggcgcagggcctgatg
gtcggcgggcaggactgccaccccaagacctccggtgcccataccggcgacgtctcggcc
gcgatgctcgccgatgcgggggcgagccacgtcattctcggccattccgaacgccgcgcc
gatcatggcgagacggactcgctcgtgcggctgaaggccgaagcggcctggggcgcgggc
cttgtcgccatcgtctgcgtgggcgaaaccgaggcccagcgcgacgcgggccagacgctc
gacgtgatcggggcacagcttgcgggctcggtgccggaagccgccaccgcggccaacacc
gtgatcgcctacgagccggtctgggccatcggcaccggccgcacgcccacgaccgccgag
atcgccgaggttcacgccttcctccgcgcgcggctcgccgagcggttttcggatgcggag
ggcttccggctgctctacggcggctcggtgaagccgtcgaatgcggccgagatcttcgcc
gtgccgaatgtcgatggcgcgctcgtcggcggcgcgagcctcaaggccgcggatttcggc
gggatcgtggcggccctttcggccgcctga

DBGET integrated database retrieval system