KEGG   Rhodobacter sphaeroides KD131: RSKD131_0547Help
Entry
RSKD131_0547      CDS       T00844                                 

Definition
methylesterase CheB/methylase CheR
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rsk02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rsk02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:541656..545168
Genome map
AA seq 1170 aa AA seqDB search
MTEMPSAAESAADRDLVLLGIGASAGGLEAFQSLLGALRPTDRFALILVQHLDPEHESLL
PELLSKRTRLPVQSIEDGMEIEGGNVYLIPPAFGLDIRGRVLKLVPFEAPRGLRRPIDSF
FQALAREHGSNAAGVILSGTGSDGSNGVRAIKEAGGLVFAQDPKDARYDGMPRSAIGTGA
VDLVLPAAEMIGVLRDFHDRASGIAPTIESDAEFIEKVVRNVRYRTGHDFSGYKSGTLLR
RITLRMSVLGLTEPGDYLRELVQNRGEADRLFRDLLINVTSFFRDPAAFDALARVAIPGI
LEEKGRGDELRVWVPGCSTGQEAYTVAMILADAMTRLDVRARLCVFGTDIDEDALAIARR
AQYPNSIASEVPPQFLERYFTPTRHGFEVRGELRDLVRFSSQSLVKDPPFSRLDLITCRN
LLIYFNHELQELAQRVFHYALRPGGFLMLGPSETAKAEGDPFVNVVPEHRIYRRNDALAR
SLDLPRGFRGISLASEPTHDALPEQIFGLPYAAAEALVVRHVPPFLLIGPQDEVTRVGAG
AERFVRLNPGTASLGIRALILPELEQPLKRLLTGSGLAGGSFRQTRVEFSRDGEAQEVMI
GCETLSNGLRLVTFGTIASPSSGSAADPDTRIVLDEAYVSQIEDELEEARLMVRTTVEEL
ETSNEELKSSNEEMMSMNEELQSANEELSTTNEELQTKLAELAEANADLANFMSSTQIAT
VFLDRELRLRSFTPEAATWFRFVEQDRGREITDIRARLDIGTIADVCRRVMAEGPAEEVA
MVSTDGESEVIVRFAPYRSGSGDRGGVVFSIFDVTAVTRYARAAEEASAEARASAEEIEE
LYLGSPGAMGLVDRDFRYLRANPKMADFSGLPNESLIGRSISEVHPDVAGRMVASIRRVF
DSGEPVLRQVVRGTTPADPDVPRVWEIDWYPVHRSDGVRAVGFNVTDVTRLLELQADLRR
IMRELQHRVKNMLSNVIALVNRARREQGDPQEILETLAQRIRALANTHNLLTSENWASTS
LSDIFALELLNVYGEERVTLRGPEMRLNARATLSLGMVIHELATNASKYGAFSRPEGRVS
VRWSRVDEGEGEEFRLVWQESGGPTVNPPSREGFGTQLMRSMVEGSFYGSIESNWEPAGL
RLVVALPWNAATEVDYDSDLDPLRHADPLP
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaatgccttccgccgccgaatccgcggccgatcgcgacctggtccttctcggg
atcggggcctcggccggcgggctggaggccttccagagcctgctcggtgcgctgaggccg
accgaccggttcgcgctgatcctcgtgcagcatctcgatccggaacatgaaagcctgctg
cccgagcttctgtccaagcgcacgcggctgccggtgcagtccatcgaggacggaatggag
atcgagggcggcaacgtctatctcattccgccggccttcggcctcgacatccgcggccgg
gtcctgaagctcgtgccgttcgaggcgccgcgggggctgcgccggcccatcgacagcttc
ttccaggcgctcgcgcgcgagcatggcagcaacgcggcgggcgtgatcctgtcgggcacg
ggatcggatggatcgaacggcgtccgggcgatcaaggaggcgggcggtctcgtcttcgcg
caggatcccaaggacgcccgctacgacggcatgccccgctcggccatcggcacgggggcg
gtcgatctcgtgctgcctgcggccgagatgatcggcgtgctgcgcgatttccacgaccgc
gcctcggggatcgcgccgaccatcgagagcgacgcggagttcatcgagaaggtggtgcgc
aacgtgcgctaccgcacgggccacgacttctccggttacaagagcggcacgctcctgcgg
cgaatcacgctgcgcatgtcggtgctggggcttacggagcccggcgactatctgcgcgaa
ctggtgcagaaccggggcgaggcggatcggcttttccgtgacctgctcattaacgtcacc
agcttcttccgcgaccctgcggccttcgacgcgctggcgcgggtggcgatccccgggatc
ctcgaggagaagggccgcggcgacgagctgcgggtctgggtgccgggctgttccacgggg
caggaggcctatacggtcgcgatgatcctcgccgacgcgatgacgcggctcgacgtgcgt
gcccggctctgcgtcttcgggaccgacatcgacgaggatgcgctcgccatcgcgcggcgg
gcgcaatatcccaattccatcgcctccgaggtgccgccgcagtttcttgagcgctacttc
acccccacccggcacggtttcgaggtgcgcggagagctgcgcgacttggtgcgcttctcg
tcccagagcctcgtgaaggatccgcccttctcccgcctcgacctcatcacctgccgcaac
ctgctgatctacttcaatcacgagctgcaggagctggcgcagcgcgtgtttcactacgcg
ctccggcccggcggtttcctgatgctcggcccctccgagacggccaaggccgagggcgac
cctttcgtgaacgtggtgcccgagcaccggatctaccggcgcaacgatgcgctggcgcgc
tcgctcgacctgccgcgcggcttccggggcatctcgcttgcctccgagcccacgcacgat
gcgctgcccgagcagatcttcgggctgccctatgccgcggccgaggcattggtcgtgcgc
catgtgccgccgttcctgctcatcggaccgcaggacgaggtgacgcgcgtgggggcgggc
gccgagaggttcgtccgtctcaatcccggcaccgcgtcgctcggtatccgggcgctgatc
cttcccgagctcgagcagccgctgaagcggcttctgaccggaagcgggctcgccggcggc
agcttccgccagacgcgggtcgagttctcccgcgacggagaggcgcaagaggtgatgatc
ggctgcgagaccctgtcgaacggtctgcgtctcgtgaccttcggcacgatcgccagcccc
tcctccggctccgccgccgatccagacacgcggatcgtgctcgacgaggcctatgtgagc
cagatcgaggacgagctcgaggaggcgcgcctgatggtgcgcaccacggtcgaggagctc
gagacctcgaacgaggagctgaagagctcgaacgaagaaatgatgtcgatgaacgaggag
ctccagtcggcgaacgaagagctctcgaccaccaacgaggagctgcagaccaagctcgcc
gaacttgccgaggccaatgcggacctcgcgaacttcatgtcctccacccagatcgcgacc
gtcttcctcgaccgcgagctgcggttgcgctccttcaccccggaggccgccacctggttc
cgcttcgtcgagcaggatcgcggacgcgagatcaccgacatccgcgcgcgcctcgacatc
gggaccattgccgatgtctgccgccgggtgatggcggagggcccggccgaagaggtggcg
atggtttcgaccgatggcgagtccgaggtgatcgtgcggttcgcgccctatcgcagcggt
tcgggcgatcggggcggggtggtcttctcgatcttcgacgtcaccgccgtcacccgctac
gcccgcgccgccgaggaggcctcggccgaagcccgtgccagcgccgaggagatcgaggag
ctttacctcggcagccccggcgcgatgggcctcgtggaccgcgacttccgctatctgcga
gccaatcccaagatggccgatttcagcggcctgcccaacgagagcctcatcggccgctcg
atatcggaggttcatcccgacgtggcggggcgcatggtggcctcgatccgccgggtgttc
gacagcggcgagccggtgctgcggcaggtggtgcgcgggacgacgcctgccgatcccgac
gtgccgcgcgtctgggagatcgactggtatcccgtccatcgctcggacggggtgcgggcg
gtgggcttcaacgtcaccgacgtcacccggcttctggaacttcaggccgatctgcgccgc
atcatgcgcgagttgcagcaccgggtgaagaacatgctgtcgaacgtgatcgcgctcgtc
aatcgcgcgcgccgcgagcagggcgatccgcaggagatcctcgagacgctggcgcagcgg
atccgggcgctggccaacacccacaatctgctcacctcggaaaactgggcctcgacctcg
ctcagcgacatcttcgcgctcgagcttctgaacgtctatggcgaggagcgggtgacgctc
cgcggccccgagatgcggctcaacgcccgcgccacgctgagcctcggcatggtgatccat
gaactcgccaccaacgcgtcgaaatacggtgccttctcgcggccagaggggcgcgtgtcg
gtgcgctggtcgcgggtggacgagggagaaggcgaggaattccgtctggtgtggcaggag
agcggcggtccgacggtaaatccgccctcgcgcgagggtttcggcacgcaattgatgcgt
tcgatggtagagggctccttctacggcagcatcgagagcaactgggaaccggccggtctt
cgcctcgttgtggccctgccatggaatgcagcaaccgaagtggactatgacagtgacctg
gaccccctccgccatgcggatcctctaccttga

DBGET integrated database retrieval system