KEGG   Rhodobacter sphaeroides KD131: RSKD131_0660Help
Entry
RSKD131_0660      CDS       T00844                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00010  Glycolysis / Gluconeogenesis
rsk00030  Pentose phosphate pathway
rsk00051  Fructose and mannose metabolism
rsk00052  Galactose metabolism
rsk00680  Methane metabolism
rsk01100  Metabolic pathways
rsk01110  Biosynthesis of secondary metabolites
rsk01120  Microbial metabolism in diverse environments
rsk01130  Biosynthesis of antibiotics
rsk01200  Carbon metabolism
rsk01230  Biosynthesis of amino acids
Module
rsk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSKD131_0660
   00030 Pentose phosphate pathway
    RSKD131_0660
   00051 Fructose and mannose metabolism
    RSKD131_0660
   00052 Galactose metabolism
    RSKD131_0660
  Energy metabolism
   00680 Methane metabolism
    RSKD131_0660
Enzymes [BR:rsk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RSKD131_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ACM00520
UniProt: B9KPM7
Position
1:complement(659655..660581)
Genome map
AA seq 308 aa AA seqDB search
MTLNPAIDLAADVPQVLPGIKLRCTEPRVDPGGGGLNVSRAIRILGGRSTAFVALGGNIG
GRLAALVAAAGIEIVAFSGPGETRESLTVTETATGRQFRFMLPGAVWDTPRVEAALARID
SAVPEGGMVVLSGSLPPGVPADFPAMVSRVLGKRARLLVDTSGAPLAHLAAGGVPDLDIL
RMDDGEAAGLAGRPLACASETADFASSLVARGVAECVIVARGADGSVLADARGRWHARSE
PVEVVSAVGAGDTFVGAFVLALARGAPPEEALAHGVAGAAAAVLTEATELCHPEDVARLL
PSAAATAL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
ttgacgctgaacccggcgatcgacctcgcggccgacgtgccgcaggtcctgccgggcatc
aagctgcgctgcaccgagccccgggtcgatccgggcggcggcgggctgaacgtcagccgc
gccatccgcatcctcggcggccggagcaccgccttcgtggccctgggcggcaacatcggc
gggcggctggccgccctggtcgcggcggccggcatcgagatcgtggccttctcgggcccc
ggcgagacgcgcgaaagcctcaccgtcaccgaaacggccacgggccggcagttccgcttc
atgctgccgggcgccgtctgggacacgccgcgggtcgaggcggctctggcccggatcgac
agcgcggtgcccgaggggggcatggtggtcctctcgggctcgctgccgcccggcgtgccc
gccgacttcccggccatggtctcccgggtgctgggcaagcgcgcccggcttctggtcgat
acgtccggcgcaccgctcgcccatctggcggcgggcggggtgcccgacctcgacatcctg
cggatggacgatggcgaggccgcgggcctcgcgggccgccccctcgcctgcgcctccgaa
acggccgatttcgcctcgagcctcgtggcccgcggcgtggccgagtgcgtgatcgtcgcc
cgcggcgccgacggctcggttctggccgatgcccgcggccgctggcacgcccgctccgaa
ccggtcgaggtggtgagcgctgtgggtgcgggcgacacgttcgtcggcgccttcgtcctc
gcccttgcgcggggcgccccgccggaagaggcgctggcccatggcgtggccggcgccgcg
gcggccgtcctcaccgaggcgaccgaactctgccatcccgaggatgtggcgcgcctcctg
ccctccgccgccgcgacggccctctga

DBGET integrated database retrieval system