KEGG   Rhodobacter sphaeroides KD131: RSKD131_0660Help
Entry
RSKD131_0660      CDS       T00844                                 

Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSKD131_0660
   01230 Biosynthesis of amino acids
    RSKD131_0660
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSKD131_0660
   00030 Pentose phosphate pathway
    RSKD131_0660
   00051 Fructose and mannose metabolism
    RSKD131_0660
   00052 Galactose metabolism
    RSKD131_0660
  Energy metabolism
   00680 Methane metabolism
    RSKD131_0660
Enzymes [BR:rsk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RSKD131_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(659655..660581)
Genome map
AA seq 308 aa AA seqDB search
MTLNPAIDLAADVPQVLPGIKLRCTEPRVDPGGGGLNVSRAIRILGGRSTAFVALGGNIG
GRLAALVAAAGIEIVAFSGPGETRESLTVTETATGRQFRFMLPGAVWDTPRVEAALARID
SAVPEGGMVVLSGSLPPGVPADFPAMVSRVLGKRARLLVDTSGAPLAHLAAGGVPDLDIL
RMDDGEAAGLAGRPLACASETADFASSLVARGVAECVIVARGADGSVLADARGRWHARSE
PVEVVSAVGAGDTFVGAFVLALARGAPPEEALAHGVAGAAAAVLTEATELCHPEDVARLL
PSAAATAL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
ttgacgctgaacccggcgatcgacctcgcggccgacgtgccgcaggtcctgccgggcatc
aagctgcgctgcaccgagccccgggtcgatccgggcggcggcgggctgaacgtcagccgc
gccatccgcatcctcggcggccggagcaccgccttcgtggccctgggcggcaacatcggc
gggcggctggccgccctggtcgcggcggccggcatcgagatcgtggccttctcgggcccc
ggcgagacgcgcgaaagcctcaccgtcaccgaaacggccacgggccggcagttccgcttc
atgctgccgggcgccgtctgggacacgccgcgggtcgaggcggctctggcccggatcgac
agcgcggtgcccgaggggggcatggtggtcctctcgggctcgctgccgcccggcgtgccc
gccgacttcccggccatggtctcccgggtgctgggcaagcgcgcccggcttctggtcgat
acgtccggcgcaccgctcgcccatctggcggcgggcggggtgcccgacctcgacatcctg
cggatggacgatggcgaggccgcgggcctcgcgggccgccccctcgcctgcgcctccgaa
acggccgatttcgcctcgagcctcgtggcccgcggcgtggccgagtgcgtgatcgtcgcc
cgcggcgccgacggctcggttctggccgatgcccgcggccgctggcacgcccgctccgaa
ccggtcgaggtggtgagcgctgtgggtgcgggcgacacgttcgtcggcgccttcgtcctc
gcccttgcgcggggcgccccgccggaagaggcgctggcccatggcgtggccggcgccgcg
gcggccgtcctcaccgaggcgaccgaactctgccatcccgaggatgtggcgcgcctcctg
ccctccgccgccgcgacggccctctga

DBGET integrated database retrieval system