KEGG   Rhodobacter sphaeroides KD131: RSKD131_0705Help
Entry
RSKD131_0705      CDS       T00844                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    RSKD131_0705
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RSKD131_0705
Enzymes [BR:rsk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RSKD131_0705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:699292..699840
Genome map
AA seq 182 aa AA seqDB search
MCRDNAMTVRPHLALAFACLAAPALAAGPPPLTFDSIDGGQIRLDELRTAGPVLVVNTAS
LCGFTPQYDDLQALWDRYRDAGLTVLAVPSNDFKQELDDAGAVRDFCATNFDLTLPMTTI
TPVTGAEAHPFYRWLAQEHGVEPRWNFHKVLIDREGDLVASWSSPVRPTDREIVGRIEAL
LP
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
ttgtgccgggacaatgccatgaccgtccgtccgcaccttgcgctcgcctttgcctgtctc
gccgcgcccgccctcgccgcggggccgccgccgctcaccttcgactcgatcgacggcggg
cagatccgcctcgacgagttgcgcacggcgggcccggtgctggtggtgaacacggcctcg
ctctgcggcttcaccccgcaatacgacgatctccaggcgctctgggaccgctaccgcgac
gcggggctgacggtcctcgccgtgccgtcgaacgatttcaagcaggagctggacgacgcg
ggcgcggtgcgcgacttctgcgccaccaacttcgacctgacgctgcccatgaccaccatc
acgccggtgaccggcgccgaggcccatcccttctaccgctggcttgcgcaggaacacggg
gtcgagccccgctggaacttccacaaggtgctgatcgaccgcgaaggggatctggtggcg
agctggtcctcgccggtgcggccgacagaccgcgagatcgtgggccggatcgaggcgctc
ctgccgtga

DBGET integrated database retrieval system