KEGG   Rhodobacter sphaeroides KD131: RSKD131_0734Help
Entry
RSKD131_0734      CDS       T00844                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:rsk00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(731758..732630)
Genome map
AA seq 290 aa AA seqDB search
MRLRTVVWPEGAAGTVLIFSGRTEYAEKYGPAAEALRRRGFASATLDWRGQGLSDRSLRD
PLVGHVDDFASYQQDVTAFVAALRAQGLPEPFHLLAHSMGGCIGLRALHEGLPVRAACFS
APMWGIRVHAALRIVAAALGALARATGLGHRYVPGTGTRSYVATAAFDTNVLTRDPEMFA
WMQEQLVQAPELGLAGPSLDWLRAAFEETARLKRLPAPDLPALCIVGSAEKVVDLEEIQR
RMEGWRRGELQIVPGAEHEVMMDRPEVRDAFFDAAAALFRASADPDAVRS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgcggctgcgcaccgtggtctggcccgagggggcggcgggaaccgtcctcatcttctcg
ggccgcaccgaatatgccgagaaatacggccccgcggccgaggcgctgcgccggcgcggc
tttgcctcggccaccctcgactggcgcggacagggcctgtcggaccggtcgctccgcgat
ccgctcgtgggccatgtcgacgatttcgcctcctatcagcaggatgtgacggccttcgtc
gcggccctgcgcgcgcaggggctgcccgagcccttccatcttctggcccattcgatgggc
ggctgcatcgggctccgcgcgctgcacgaggggctgcccgtgcgcgccgcctgcttctcg
gcgccgatgtggggcatccgcgtccatgccgcgctgcggatcgtggcggcggcactcggg
gcgctcgcccgcgcgacggggctcgggcaccgctatgtccccggcaccggcacgcgcagc
tatgtcgccaccgccgccttcgacacgaacgtcctcacccgcgaccccgagatgttcgcc
tggatgcaggagcagctggtgcaggcgccggaactcggtcttgccggcccgagcctcgac
tggctgcgcgcggccttcgaggagacggcacggctgaagcggctgcccgcgccggatctg
cccgcgctctgcatcgtgggctcggccgagaaggtcgtcgatctcgaggagatccagcgc
cggatggagggctggcgccggggcgagttgcagatcgtgcccggggccgagcacgaggtg
atgatggaccgccccgaggtgcgcgacgccttcttcgacgcggccgcggccctgttccgg
gcgagcgcggacccggacgccgtcagatcctga

DBGET integrated database retrieval system