KEGG   Rhodobacter sphaeroides KD131: RSKD131_0762Help
Entry
RSKD131_0762      CDS       T00844                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RSKD131_0762
Enzymes [BR:rsk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     RSKD131_0762
Exosome [BR:rsk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RSKD131_0762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:765381..767522
Genome map
AA seq 713 aa AA seqDB search
MAAIMRGTHGDPFRVLGMHGGGGAPLSVRVFAPQAAEVAVLGQGGEVLASLERIGAEGFF
AGTVPGEEKFPYRLRFVSGPHEWEADDPYRFPEVLGELDEYLLGEGRHYQLYTRLGAHPA
EIEGVQGVSFAVWAPNARRVSVVGAFNAWDGRRHPMRKRIGVGVWELFVPGLHTGDLYKY
EILGPSGERLPLKSDPLSFAQEAPPATASVVHGLPEAEWHDAGWMQERESRQRRDAPISI
YEVHAGSWRQGLDYDALAEELSAYVREMGFTHVEFLPISEHPFTGSWGYQPIGLFAPTAR
FGPPEGFARLVDRLHRDGIGVILDWVPAHFPSDAHGLANFDGTHLYDHADPRQGFHRDWN
TQIYNFGRQEVANFLQASALFWLDRYHVDALRVDAVASMLYLDYSRNAGEWVPNRHGGRE
NLEAIDFLRGVNERVRLDHPGCITIAEESTAFPQVSRPVEDGGLGFGFKWNMGWMHDTLG
YFRRDPIHRKHHQNDLTFGMVYAYSEDFVLPLSHDEVVHGKGSLIGQMAGDRWQKFANLR
AYFGFMWAHPGKKLLFMGGEFAQEREWNHDASLDWHLLDDPSHAGMKRLVADLNREYRKR
PALHRMDCDPEGFEWIDAGDTENSVLSFLRKTPGEKPVLAVCNLTPVVRSDYRIGVPEGG
EWREILNSDAAIYGGSDVGNPGGLQAEEVSWHGRPASLRLTLPPLATIFVTPA
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
gtggccgccatcatgcgcggaacgcacggagatcccttccgcgtgctgggcatgcacgga
ggcggcggcgcgccgctgtccgtccgggtcttcgccccgcaggccgcggaggtcgcggtg
ctggggcaggggggcgaggtgctcgcctctctcgagcgcatcggcgccgagggcttcttc
gccggcacggtgccgggcgaggagaaattcccctaccgcctccgcttcgtctcgggaccg
cacgagtgggaggcggacgatccctaccgcttccccgaggtgttgggcgagctcgacgaa
tatcttctcggcgaggggcggcactatcagctctacacccggctcggcgcgcatccggcc
gagatcgagggcgtgcagggggtgagcttcgccgtctgggcgccgaatgcccgccgcgtc
tcggtcgtgggcgccttcaacgcctgggacggccgtcgccacccgatgcgcaagcgcatc
ggcgtgggcgtgtgggagctgttcgttcccggcctccataccggcgatctctacaaatac
gagatcctcgggccttcgggcgagcggttgccgctcaagtccgatccgctctccttcgcg
caggaggcgccgcccgccacggcttcggtggtccatgggctgcccgaggccgagtggcac
gatgcgggctggatgcaggagcgcgagagccgtcagcgccgcgatgcgccgatctcgatc
tacgaggtccatgccggatcgtggcggcaggggctcgattacgacgcgctggccgaggaa
ctgtcggcctatgtgcgcgagatgggcttcacccatgtggaattcctgccgatcagcgaa
catcccttcaccggctcctggggctatcagcccatcgggctcttcgcccccaccgcgcgc
ttcggtccgcccgagggcttcgcgcggctggtggaccggctccaccgcgacgggatcggc
gtcatcctcgactgggtaccggcgcacttcccgtcggacgctcatgggctggccaacttc
gacgggacccatctctatgaccatgccgacccgcggcagggcttccaccgcgactggaac
acccagatctacaacttcggccggcaggaagtggcgaacttcctgcaggcttcggcgctg
ttctggctcgaccgctaccatgtcgatgcgctgcgcgtggatgcggtggcctcgatgctc
tacctcgactattcgcggaatgccggcgaatgggtgccgaaccgccacggcgggcgcgag
aacctcgaggcgatcgatttcctgcgcggcgtgaacgagcgcgtccggctcgaccatccg
ggctgcatcaccatcgccgaggaatcgacggccttcccgcaggtgagccgcccggtcgag
gacggcgggctcggcttcggcttcaagtggaacatgggctggatgcacgacacgctgggc
tacttccggcgcgacccgatccaccgcaagcaccaccagaacgacctgaccttcggcatg
gtctatgcctattccgaggatttcgtcctgcccctcagccatgacgaggtggtgcacggc
aagggctcgctcatcgggcagatggcgggcgaccgctggcagaagttcgcgaaccttagg
gcctatttcggcttcatgtgggcgcatccgggcaagaagcttctcttcatgggcggcgag
ttcgcgcaggagcgcgagtggaaccacgatgcctcgctcgactggcacctgctcgacgat
ccgtcccacgccgggatgaagcgcctcgtggccgacctgaaccgtgaatatcgcaagcgc
cccgcgctgcaccggatggattgcgatcccgaagggttcgagtggatcgatgccggcgat
accgagaacagcgtgctgagcttcctgcgcaagacgcccggcgagaagccggtgctggcg
gtctgcaacctcacgcccgtggtgcggtcggattaccggatcggggtgcccgagggcggc
gagtggcgcgagatcctcaactccgacgccgcgatctatggcggctcggacgtgggcaat
cccggcggtcttcaggccgaggaggtctcctggcacggccggccggcctcgctgcgcctg
acgctgccgccgcttgcgacgatcttcgtgacgcctgcatga

DBGET integrated database retrieval system