KEGG   Rhodobacter sphaeroides KD131: RSKD131_0765Help
Entry
RSKD131_0765      CDS       T00844                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RSKD131_0765
Enzymes [BR:rsk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     RSKD131_0765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:771357..773174
Genome map
AA seq 605 aa AA seqDB search
MSRTIEDRAAEFAIQPSYHALGGEFVRAPVETLREMLGAFGIPLDGPPPDRAPPEMRAPD
GYRCFLPEGEMRRWGIAAQLYQLRSERNWGIGDFADLCDLARIGGAAGADFIGLNPLHAL
FLANPAHTSPFSPSNRRFLNPLYIAVDRVPGYRPEFAPEGLDRLRAPDLVDYPAVAAAKL
GALRRLWREGPDDAMGFMRFCAEGGELLRRHALFEAISGQMVADGYGAGWLGWPVEFHDA
EGQSVIDFADARGDEVGFHLWLQWIADRQLEEARDACRAAGMKIGLYLDFAVGEVPDGSS
TWSDPSLAVPGLRIGASPDWFNAQGQDWGLAPLSPVKLADLRAAPFGALMQDATRRAGAL
RIDHAMGVWQLFLIPDGMGAPQGTYVRYPIEDMLRALAEASCRNRTIVIGEDLGNVPDGF
RELMARMNILSYRILLFERHDHGYIAPEHYPREALVCLSTHDLPTFRGWWRGDDVAIRRD
FHLISDEAARQQGDFRWTERRQLLEDLARAGLMSWDEIDRIGPDDPPEALVVAVHRHLAR
APSRLFAVRIEDMAGEVAPVNVPSTVDEHPNWRRRLGVPLEALGETALFRGIAGALEAER
PREPS
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgagccggaccatcgaagacagggcggccgagttcgccatccagcccagctatcacgcg
ctcggcggcgaattcgtccgcgcgccggtcgagacgctgcgcgaaatgctcggcgccttc
ggcatcccgctggacggaccgccaccggaccgggcgccgcccgagatgcgggcgcccgac
ggctaccgctgcttcctgcccgagggcgagatgcgccgctggggcatcgccgcgcaactc
taccagctgcggtccgagcgcaactggggcatcggcgacttcgccgatctctgcgatctg
gcgcggatcggaggcgccgcaggggccgatttcatcggcctgaacccgctccacgccctg
tttctggccaatcccgcccacaccagccccttctcgccctcgaaccggcgcttcctgaac
ccgctctacatcgcggtcgaccgcgtgccgggctacaggcccgagttcgcgcccgagggg
ctggatcggctgcgcgcgcccgatctcgtcgactatccggcggtggccgcagccaagctc
ggcgcgctgcgccgtctgtggcgcgaggggccggacgatgcgatgggcttcatgcgcttc
tgcgccgagggcggtgagcttctgcgccgccacgcgctcttcgaggcgatctcgggccag
atggtggcggacggttacggcgcgggctggctcggctggcccgtggagttccacgacgcc
gaaggccagtccgtcatcgacttcgccgacgcacggggcgacgaggtgggcttccacctc
tggctgcagtggatcgccgaccggcagctcgaagaggcgcgcgatgcctgccgcgccgcc
gggatgaagatcgggctctatctcgacttcgccgtgggcgaggtgccggacggatcgagc
acctggtcggatccgagccttgccgtgccgggtctccggatcggcgcctcgcccgactgg
ttcaacgcgcaggggcaggactggggtctggcacccctctctccggtgaagctcgccgat
ctgcgtgcggcccccttcggggcgctgatgcaggatgccacgcgccgggccggcgcgttg
cggatcgaccatgcgatgggcgtctggcagctcttcctcatccccgacgggatgggcgcg
ccgcagggcacctatgtgcgctatccgatcgaggacatgctgcgcgcgctggccgaagcc
tcgtgccgcaaccgcaccattgtgatcggcgaagacttgggcaacgtgcccgacggcttc
cgcgagctgatggcgcggatgaacatcctttcctaccgcatcctgctcttcgagcggcac
gaccacggctatatcgcgccagagcattatccgcgcgaggcgctcgtgtgcctctccacc
cacgacctgcccaccttccgcggctggtggcggggcgacgatgtggcgatccggcgcgac
ttccacctgatctcggacgaggccgcccgccagcagggcgacttccgctggaccgagcga
cgccagctgctcgaggatctggcgcgggcgggcctgatgtcgtgggacgagatcgaccgg
atcggccccgacgatccgcccgaggcgctggtcgtggcggtgcaccgccatctcgcccgg
gcgccctcgcgcctcttcgcggtgcggatcgaggacatggcgggcgaggtggccccggtg
aacgtgccctcgaccgtggacgaacatcccaactggcggcgcaggctcggcgtgccgctg
gaggctctgggcgagaccgcgctgttccgcggcatcgccggggcccttgaagccgagcga
ccaagggagccctcatga

DBGET integrated database retrieval system