KEGG   Rhodobacter sphaeroides KD131: RSKD131_0799Help
Entry
RSKD131_0799      CDS       T00844                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSKD131_0799
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSKD131_0799
   00020 Citrate cycle (TCA cycle)
    RSKD131_0799
   00620 Pyruvate metabolism
    RSKD131_0799
Enzymes [BR:rsk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RSKD131_0799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(802991..804319)
Genome map
AA seq 442 aa AA seqDB search
MATEILMPALSPTMEEGTLAKWLKKEGDEVRSGDIIAEIETDKATMEFEAVDEGILGKIL
IAEGTAGVKVNTPIAVLVEEGESVDAVSSAKVPEPQEPADEAAPAQGAPKAAPAPAAKAP
EAQAARSEGGRVFASPLARRIAKEKGIDLAAVQGSGPRGRIVKADVEGAQPVAAPAAKAD
AAAPKAEAPAAAAAPVAAPAASAASVAKLFADRDYEEVTLDGMRKTIAARLSEAKQTIPH
FYLRREVALDALMAFRADLNAKLESRGVKLSVNDFIIKACAVALQQVPNANAVWAGDRIL
RLKPSDVAVAVAIEGGLFTPVLRDAHQKSLSALSAEMKDLAARARTKKLAPHEYQGGSFA
ISNLGMFGVENFDAVINPPHGSILAVGAGIRKPVVGKDGAITTATMMSMTLSVDHRVIDG
ALGAEFLKAIVENLENPIAMLA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgagatcctgatgcccgcgctgtctccgacgatggaggaggggacgctcgcg
aaatggctgaagaaggaaggggatgaggtccgctcgggcgacatcatcgccgagatcgag
accgacaaggccaccatggagttcgaggcggtcgacgagggcatcctcggcaagatcctg
atcgccgagggcacggcaggcgtgaaggtcaacacgcccatcgccgtgctggtggaagag
ggcgagagcgtggacgccgtgtcctccgccaaggtgccggagccgcaggaaccggccgac
gaggccgcacccgcgcagggggctccgaaggcggcccctgccccggccgccaaggcgccc
gaggcgcaggcggcccgatccgagggagggcgcgtcttcgcctcgccgctcgcccgccgg
atcgccaaggaaaaggggatcgacctggcggccgtgcagggctcgggcccccgcggccgg
atcgtgaaggccgatgtcgagggggcgcaacccgtggccgctcccgccgccaaggcggat
gccgcggcaccgaaggcagaagcgcccgccgctgcggccgcgcccgtcgccgcgccggcg
gcctccgcggcttcggtggcgaagctcttcgcggatcgcgactatgaggaagtgaccctc
gacgggatgcgcaagaccattgccgcgcgtctgtccgaggccaagcagaccatcccgcac
ttctacctccgccgcgaggtggctctggatgcgctgatggccttccgcgccgatctcaac
gcgaagctcgagagccggggcgtgaagctctcggtcaacgacttcatcatcaaggcctgt
gcggtggcgctccagcaggtgccgaacgcgaatgccgtctgggccggagaccggatcctg
cggctgaagccctcggacgtggcggtggccgtggcgatcgagggcgggctcttcacgccg
gtcctgcgcgatgcgcaccagaagagcctgtcggcgctgtcggccgagatgaaggatctc
gccgcccgtgcccgcacgaagaagctcgcaccgcacgaatatcagggcggcagcttcgcg
atctcgaacctcggcatgttcggggtcgagaatttcgatgcggtcatcaacccgccgcac
ggctcgatcctcgccgtcggggcaggcatccgcaagccggtggtgggcaaggacggggcc
atcacgaccgccaccatgatgtcgatgacgctctcggtggaccaccgggtgatcgacggc
gcgctgggggccgagttcctgaaggcgatcgtcgagaatctcgagaacccgatcgccatg
ctggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system