KEGG   Rhodobacter sphaeroides KD131: RSKD131_0889Help
Entry
RSKD131_0889      CDS       T00844                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RSKD131_0889
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RSKD131_0889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:898962..899390
Genome map
AA seq 142 aa AA seqDB search
MTTILAGALALGAAQAAFAEGDPAAGEKAFRKCQACHQIGAEAQNKTGPVLTGVIGRPAA
SIEGFSYSKTLTEAAADGLVWDHAALETFLANPRKAMPGTKMAFPGIKKPQELADILAYL
DTFSDGETREAEETPAAAPAEG
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
ttgaccaccatcctcgccggggcgctcgctctcggtgccgcgcaggccgccttcgccgaa
ggcgacccggcggccggcgagaaggccttccggaaatgtcaggcctgccaccagatcggc
gccgaggcgcagaacaagaccgggcccgtcctgaccggcgtcatcggccgcccggcggcc
tcgatcgagggtttcagctattccaagaccctgaccgaggccgcggccgatggcctcgtc
tgggaccatgccgcgctcgagaccttcctggccaatccgcgcaaggcgatgccgggcacc
aagatggccttccccggcatcaagaaaccgcaggagctggccgacattctggcctatctc
gacaccttctcggacggggaaacgcgggaggccgaagagacccccgccgcggcgccggcg
gagggctga

DBGET integrated database retrieval system