KEGG   Rhodobacter sphaeroides KD131: RSKD131_1100Help
Entry
RSKD131_1100      CDS       T00844                                 

Definition
D-beta-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rsk00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:rsk00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1108737..1109534)
Genome map
AA seq 265 aa AA seqDB search
MHMTGGRIMDLNGKRAIVTGSNSGIGLGCAEELARAGAEVVINSFTDRDEDHALAEKIGR
EHGVSCRYIAADMSDGEACRALIETAGGCDILVNNAGIQHVSSIEEFPVEKWNAILAINL
SSAFHTTAAALPGMRAKGWGRIVNIASAHGLTASPYKSAYVAAKHGVVGFTKVTALETAG
KGITCNAICPGYVLTPLVEAQIPDQMKAHDMDRETVIREVMLDRQPSRQFATTGQIGGTV
VFLCSGAADQITGTTISVDGGWTAL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgcacatgacgggaggcaggatcatggatctgaacggcaagcgggcaatcgtcaccggc
tcgaactcgggcatcgggctgggctgcgccgaggagctggcgcgcgccggcgccgaggtt
gtcatcaactccttcaccgaccgcgacgaggatcacgcgctggccgagaagatcggccgc
gaacatggcgtgagctgccgctacatcgcggcggacatgtcggacggcgaagcgtgccgg
gcgctgatcgagacggcgggcggctgcgacatcctcgtgaacaatgcgggcatccagcat
gtctcgtcgatcgaggagttcccggtcgagaagtggaacgcgatcctcgcgatcaacctc
tcgtcggccttccacaccacggccgcggcgctgccggggatgcgggcgaagggctggggg
cggattgtcaacatcgcctcggcgcacgggctgacggcgagcccctacaagtcggcctat
gttgcggccaagcacggggtggtgggcttcaccaaggtcaccgcgctcgagaccgcgggc
aagggcatcacctgcaacgcgatctgcccgggctatgtgctgacgccgctggtcgaggcc
cagatccccgaccagatgaaggcgcacgacatggaccgcgagacggtgatccgcgaggtg
atgctcgaccgccagccctcgcggcagttcgccacgaccggacagatcggcggaacggtg
gtgttcctctgctcgggtgcagccgatcagatcaccgggacgacgatctcggtggatggg
ggctggaccgccctctga

DBGET integrated database retrieval system