KEGG   Rhodobacter sphaeroides KD131: RSKD131_1100Help
Entry
RSKD131_1100      CDS       T00844                                 

Definition
D-beta-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RSKD131_1100
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    RSKD131_1100
Enzymes [BR:rsk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     RSKD131_1100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1108737..1109534)
Genome map
AA seq 265 aa AA seqDB search
MHMTGGRIMDLNGKRAIVTGSNSGIGLGCAEELARAGAEVVINSFTDRDEDHALAEKIGR
EHGVSCRYIAADMSDGEACRALIETAGGCDILVNNAGIQHVSSIEEFPVEKWNAILAINL
SSAFHTTAAALPGMRAKGWGRIVNIASAHGLTASPYKSAYVAAKHGVVGFTKVTALETAG
KGITCNAICPGYVLTPLVEAQIPDQMKAHDMDRETVIREVMLDRQPSRQFATTGQIGGTV
VFLCSGAADQITGTTISVDGGWTAL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgcacatgacgggaggcaggatcatggatctgaacggcaagcgggcaatcgtcaccggc
tcgaactcgggcatcgggctgggctgcgccgaggagctggcgcgcgccggcgccgaggtt
gtcatcaactccttcaccgaccgcgacgaggatcacgcgctggccgagaagatcggccgc
gaacatggcgtgagctgccgctacatcgcggcggacatgtcggacggcgaagcgtgccgg
gcgctgatcgagacggcgggcggctgcgacatcctcgtgaacaatgcgggcatccagcat
gtctcgtcgatcgaggagttcccggtcgagaagtggaacgcgatcctcgcgatcaacctc
tcgtcggccttccacaccacggccgcggcgctgccggggatgcgggcgaagggctggggg
cggattgtcaacatcgcctcggcgcacgggctgacggcgagcccctacaagtcggcctat
gttgcggccaagcacggggtggtgggcttcaccaaggtcaccgcgctcgagaccgcgggc
aagggcatcacctgcaacgcgatctgcccgggctatgtgctgacgccgctggtcgaggcc
cagatccccgaccagatgaaggcgcacgacatggaccgcgagacggtgatccgcgaggtg
atgctcgaccgccagccctcgcggcagttcgccacgaccggacagatcggcggaacggtg
gtgttcctctgctcgggtgcagccgatcagatcaccgggacgacgatctcggtggatggg
ggctggaccgccctctga

DBGET integrated database retrieval system