KEGG   Rhodobacter sphaeroides KD131: RSKD131_1112Help
Entry
RSKD131_1112      CDS       T00844                                 

Definition
(GenBank) Delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00860  Porphyrin and chlorophyll metabolism
rsk01100  Metabolic pathways
rsk01110  Biosynthesis of secondary metabolites
rsk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RSKD131_1112
Enzymes [BR:rsk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RSKD131_1112
Exosome [BR:rsk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RSKD131_1112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ACM00972
UniProt: B9KSG5
Position
1:1123479..1124483
Genome map
AA seq 334 aa AA seqDB search
MRPIQAAYPHARFRRTRRTDALRRLTQEYTLTTGDLIWPLFVRDGENIEEPIHSMPGVVR
RSVDRIVAAAEEAASLGIPAVCLFPYTDPSLKTELCEEAWNPCNLANRAIRAIKAAVPEL
AVMTDVALDPYNANGHDGLVRDGIILNDETVEALVRMALAQAEAGADILGPSDMMDGRIG
AMRTALEAAGHKDVAILSYSAKYASAFYGPFRDAVGASGALKGDKKTYQMDPGNSDEALR
LIERDLREGADMVMVKPGMPYLDICRRVKDAFGVPTYAYQVSGEYAMIRGAADRGWIKGE
AAMMESLLCFKRAGCDGILTYFAPEAARLLNGMG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccgatccaagccgcctacccccatgcccgcttccgccgcacccggcgcaccgac
gcgctgcgccggctcacgcaggaatatacgctgacaacgggcgatctgatctggccgctg
ttcgtgcgtgacggagagaatatcgaagagccgatccactccatgccgggcgtcgtgcgc
cgctcggtcgaccggatcgtggccgcggccgaggaagccgcaagcctcggcatcccggcc
gtctgcctctttccctacaccgatccgtccttgaagaccgagctctgcgaggaggcctgg
aacccctgcaacctcgccaaccgggcgatccgcgccatcaaggccgcggtgcccgagctg
gccgtcatgaccgatgtggcgctcgatccctacaatgccaacggccacgacgggctggtg
cgcgacgggatcatcctgaacgacgagacggtcgaggcgctggtccggatggcgctggcg
caggccgaggcgggcgcggacatcctcgggccctcggacatgatggatggccgcatcggc
gcgatgcggaccgcgctcgaggcggcgggccacaaggatgtggcgatcctctcctattcg
gcgaaatatgcctcggccttctacggcccgttccgcgatgcggtgggcgcctcgggcgcg
ctcaagggcgacaagaagacctaccagatggatcccggcaactcggacgaggcgctgcgg
ctgatcgagcgcgacctgcgcgagggcgccgacatggtgatggtgaagcccgggatgccc
tatctcgacatctgccggcgggtgaaggacgctttcggcgtgccgacctacgcctatcag
gtctcgggcgaatatgcgatgatccggggcgcggccgaccgcggctggatcaagggcgag
gccgcgatgatggagagcctgctctgcttcaagcgcgcgggctgcgacggcatcctcacc
tatttcgcccccgaggcggcacggcttctgaacggtatgggctga

DBGET integrated database retrieval system