KEGG   Rhodobacter sphaeroides KD131: RSKD131_1169Help
Entry
RSKD131_1169      CDS       T00844                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RSKD131_1169
Enzymes [BR:rsk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     RSKD131_1169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1187464..1188558)
Genome map
AA seq 364 aa AA seqDB search
MKAARLYEYDPAMNVRLKIEDVPAPTIDRPDEVIVKVGAAGLCRTDLHIIEGVWRDIMDS
HGSLLPYIMGHENAGWVEDVGSGVTSVKPGDAVICHPLRTCGICLNCRHGHDMHCQNNLF
PGLGLDGGFAEYFKTSERSLIKLNTGITPLSVAPMADAGITAYRAAKRAAKLLDPGDWAL
ILGVGGLGHIALQVLNEMAGCRTIAVDREPGAQVLAKELGADKVLAGGPDLIEEVRQITG
GGARVVIDFVGELGVENLCWKLLKNGGDLIMVGYGGTIEIPTLELVAREIRIGGSLVGDY
TELVELMELNADGKVKMHQTEFALEDINTAIDDFKNRRFTGRGVIVPGALSARRVEERTA
EAVK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcgaggctctacgaatacgatccggcgatgaacgtccggctgaagatcgag
gacgttccggcacccaccatcgaccggccggacgaagtgatcgtcaaagtcggggcggcc
gggctctgccgcaccgatctgcatatcatcgaaggcgtctggcgcgatatcatggacagc
catggctcgcttctgccctacatcatggggcacgagaatgcgggatgggtcgaggacgtg
ggctcgggcgtgacctcggtcaagcccggcgacgcggtgatctgccacccgctgcgcacc
tgcggcatctgcctgaactgccgccacggccatgacatgcactgccagaacaacctcttt
cccggtctcgggctggacggcggcttcgcggaatatttcaagacctccgagcggtcgctc
atcaagctgaacacggggatcacgccgctctcggtggcgccgatggccgatgccggcatc
accgcctaccgcgcggccaagcgggcggcgaagctgctcgacccgggcgactgggcgctg
atcctcggcgtgggagggctcggccatatcgccctgcaggtgctgaacgagatggcgggc
tgccggaccatcgccgtcgaccgcgagccgggcgcgcaggtgctggcgaaggagctcggc
gcggacaaggtgctggcgggcgggcccgacctcatcgaggaggtgcgccagatcaccggt
ggcggcgcccgggtggtgatcgatttcgtgggcgaactcggcgtcgagaacctgtgctgg
aagcttctgaagaacggcggggacctcatcatggtgggctatggcggcaccatcgagatc
ccgaccctcgagcttgtcgcgcgcgagatccgcatcggcggcagcctcgtcggcgattac
acggaactcgtggagctgatggagctgaacgccgacggcaaggtgaagatgcaccagacc
gaattcgcgctggaggacatcaacacggccatcgacgacttcaagaaccgccgcttcacg
gggcggggggtgatcgttccgggcgccctttcggccaggcgggtcgaagaacgaacggcc
gaagccgtgaaatga

DBGET integrated database retrieval system