KEGG   Rhodobacter sphaeroides KD131: RSKD131_1191Help
Entry
RSKD131_1191      CDS       T00844                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00010  Glycolysis / Gluconeogenesis
rsk00052  Galactose metabolism
rsk00500  Starch and sucrose metabolism
rsk00520  Amino sugar and nucleotide sugar metabolism
rsk00521  Streptomycin biosynthesis
rsk01100  Metabolic pathways
rsk01110  Biosynthesis of secondary metabolites
rsk01120  Microbial metabolism in diverse environments
rsk01130  Biosynthesis of antibiotics
rsk01200  Carbon metabolism
Module
rsk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rsk_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSKD131_1191
   00052 Galactose metabolism
    RSKD131_1191
   00500 Starch and sucrose metabolism
    RSKD131_1191
   00520 Amino sugar and nucleotide sugar metabolism
    RSKD131_1191
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RSKD131_1191
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    RSKD131_1191
Enzymes [BR:rsk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RSKD131_1191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACM01051
UniProt: B9KSP4
Position
1:1210194..1211147
Genome map
AA seq 317 aa AA seqDB search
MADAPLCLVADIGGTNTRVALAEGSRLRPETTRRFRNADYPALAPVLRDFLSVAGSPEID
GTCVAAAGPVRDGVALLTNLAWTVDGAELQRATGAPRVAVLNDLQAQGHALGHLDPANLR
VLIPGPTPRRAGPMLVVGVGTGFNAAPVHDVAGLRLVAASECGHAGMPVRTARDLRLAEF
VQTAHGFAGVEDVLSGRGLERLYAFTAAEAGLEDRKSAAEIMAAIAEPGPARAAAELFAR
LLGAEAGNLALIHLPFGGLYLCGGVARAFAAHLGPMGFAENFRDKGRFSAFMDDFPVCIV
EDDYAALTGCAAYLATL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgcgcccctttgcctcgtcgccgacatcggtggcacgaacacccgcgtggcg
ctggcggagggatcccggctgcggcccgaaacgacgcgccgcttccggaatgccgattat
cctgctctggcgccggtcctgcgcgacttcctctccgtcgccggcagccccgagatcgac
ggcacctgcgtggccgccgcgggcccggtccgggacggggtggctctgctcacgaacctc
gcctggaccgtcgacggcgccgaactgcagcgcgcgaccggcgcgccgcgcgtggcggtg
ctgaacgatcttcaggcgcagggccatgcgctgggccatctggatccggccaatctgcgc
gtcctgatcccggggcccactccccgccgcgcgggcccgatgctcgtcgtgggcgtcggc
accggcttcaacgcagcgcccgtccacgatgtcgcgggcctgcgcctggtggcggcctcc
gagtgcggccatgccgggatgcccgtccgcaccgcgcgcgacctccggctcgcggaattc
gtccagacggcccacggtttcgccggcgtcgaggatgtgctgtcgggccgcggtctcgag
cggctctatgccttcaccgcggccgaggccggcctcgaggaccgcaagtcggcggccgag
atcatggcggccatcgccgaacccggcccggcgcgcgccgcggccgagctcttcgcccgc
ctcctcggcgccgaggcgggcaatctcgccctgatccacctgcccttcggcggcctctat
ctctgcggcggcgtggcccgggccttcgccgcccatctgggcccgatgggctttgccgag
aacttccgcgacaagggccgcttctcggccttcatggacgatttcccggtctgcatcgtc
gaggacgattacgcagccctcaccggctgcgcagcctacctcgccaccctctga

DBGET integrated database retrieval system