KEGG   Rhodobacter sphaeroides KD131: RSKD131_1214Help
Entry
RSKD131_1214      CDS       T00844                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RSKD131_1214
   00240 Pyrimidine metabolism
    RSKD131_1214
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    RSKD131_1214
   03430 Mismatch repair
    RSKD131_1214
   03440 Homologous recombination
    RSKD131_1214
Enzymes [BR:rsk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     RSKD131_1214
DNA replication proteins [BR:rsk03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     RSKD131_1214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1239193..1239681)
Genome map
AA seq 162 aa AA seqDB search
MDQTEGEAGRVGVVMFYHLTRSSAEDTLRLLLPRALGQGWRVMLRGTDRARLEALDLALW
RVPEEGFLPHGMEGGPHDAVQPVLLGTGAIGNGAQALMLLDGAATEAAEAAPLERVWILF
DGLDEAELGRARGQWKALTGAGVKAQYWSEESGRWEKKAEAG
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
ttggaccagactgaaggagaggcgggccgcgtgggggtcgtgatgttctatcacctgacg
cgctcctcggccgaggacacgctgcggcttctgctgccgcgggcgctcgggcaggggtgg
cgcgtcatgctgcgggggaccgaccgggcgcggctcgaggcgctggatctggcgctctgg
cgggtgccggaggagggatttctgccgcacgggatggagggcgggccgcacgatgcggtg
cagccggtgctgctcggcaccggcgcgatcggcaacggggcgcaggcgctgatgctgctc
gacggggctgcgacggaggctgcggaggcggcgccgctcgagcgggtctggatcctgttc
gacgggctggacgaggcggagcttgggcgggcgcgcgggcagtggaaggcgctgaccggc
gcgggcgtgaaggcgcaatactggtcggaggaaagcgggcgctgggagaagaaggccgag
gcgggctga

DBGET integrated database retrieval system