KEGG   Rhodobacter sphaeroides KD131: RSKD131_1260Help
Entry
RSKD131_1260      CDS       T00844                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RSKD131_1260
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    RSKD131_1260
Enzymes [BR:rsk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RSKD131_1260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1286074..1287087)
Genome map
AA seq 337 aa AA seqDB search
MSEAGRTAAIFGCSGPVLTDAERQFFREADPFGFILFARNIDNPAQVLALTQELRSIVGR
DAPIFVDQEGGRVQRLCAPHWREWLPPFEAVERAGDRAARMLWLRYRLIAEDLRAVGIDG
NCAPVADIRTAATHPFLANRCLADEAARVAELARAVAEAHLAGGVLPVMKHLPGHGRAAA
DTHHDLPTVTASREELAATDFAAFRALADLPLAMTGHVVFSAYDAQPATLSAPMVGVIRE
EIGFSGLLMTDDLSMQALSGGIGARAGAAIAAGCDLALHCNGELAEMEAVAAAAGAMGPE
ALERAAAALARRRPPEPVDSRALEAEHSVLLGGHGHG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggccggccggacggccgcgattttcggctgctccggcccggtcctcacggat
gccgagcggcagttcttccgcgaggccgatcccttcggcttcatcctcttcgcacgcaac
atcgacaaccccgcgcaagtccttgccctgacgcaggaactgcgttccatcgtggggcgc
gacgcgcccatcttcgtcgatcaggaaggcggccgcgtccagcgtctctgcgcgccgcac
tggcgcgagtggctgccgcccttcgaggcggtggagcgcgccggagaccgtgccgcccgg
atgctctggctgcggtaccggctcatcgccgaggacctgcgggcggtgggtatcgacggc
aactgcgcccccgtggccgacatccgcaccgcggcgacccatccgttcctcgccaaccgc
tgcctcgccgacgaggccgcgcgcgtggcggagcttgcccgcgcggtggccgaggcgcat
ctggcgggcggggtcctgccggtgatgaagcatctgccgggccacggccgtgccgcggcc
gacacgcaccacgacctgcccacggtgaccgccagccgcgaggagctggccgccaccgac
ttcgcggccttccgggcgcttgcggatctgcccttggccatgacgggccatgtggtcttt
tcggcctatgatgcgcagcctgcgaccctctcggcgcccatggtcggcgtcatccgcgag
gagatcggcttttccggcctcctcatgacggacgatctgtcgatgcaggccctctcgggc
gggatcggcgcgcgggcgggggcggccatcgcggccggctgcgatctggcgctccattgc
aacggcgaactggccgagatggaggccgtggccgccgccgcaggcgcgatggggcccgag
gcgctggagcgcgccgcagcggcgctggcccgccgcaggccgcccgagccggttgacagc
cgggcgctcgaggccgaacattccgtccttctgggcgggcatgggcatggctga

DBGET integrated database retrieval system