KEGG   Rhodobacter sphaeroides KD131: RSKD131_1332Help
Entry
RSKD131_1332      CDS       T00844                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    RSKD131_1332
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RSKD131_1332
Enzymes [BR:rsk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     RSKD131_1332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1363979..1364512
Genome map
AA seq 177 aa AA seqDB search
MRFIPTTLKDAVLIEAEPREDHRGWFERTFCMEEMAGAGLKTGFVQHNSSYNHAAGTLRG
MHYQRAPHSEVKVITCTRGRIQDVIIDLRPDSPTYLKWEGFDLKAGDHRQLYVPKGFAHG
YLTLEDATAVSYLVSTAYTPGAEGGVRWDDPAFGIDWAAEVSVISEKDAAWPDFEPA
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgagattcattcccacgacgctcaaggatgccgtcctgatcgaggccgagccgagagag
gatcaccggggctggttcgagcggaccttctgcatggaggagatggccggagccggcctg
aagacgggcttcgtccagcacaacagctcctacaaccatgccgcgggaacgctgcgcggg
atgcactaccagcgcgccccccattcggaggtgaaggtcatcacctgcacccgcggccgc
atccaggacgtcatcatcgacctgcgcccggactcgccaacctacctgaaatgggaaggt
tttgacctgaaggccggcgatcaccggcaactctacgtcccgaagggcttcgcccacggc
tatctcacgctcgaagatgcgacggccgtgtcctacctcgtctcgaccgcctacaccccc
ggtgcggaaggcggcgtgcgctgggacgatcccgccttcggcatcgactgggccgccgaa
gtgtcggtgatctcggaaaaggatgcggcctggccggacttcgagccagcctga

DBGET integrated database retrieval system